Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03054 |
NCBI Accession ID | |
Organism | Clostridium,Blautia,Dorea,Roseburia,Lachnoclostridium,Ruminococcus,Coprococcus,Eubacterium,Butyrivibrio |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGGTAAGAAAAAGAAACAAAAGAAAAAGCCTATCGAATGGCGAGACCTGACAATCAACGCATTGATAGACTTAATCATAGGCATAATACTTATCATAATCGGTAAGTACATAGGTTAG |
Sequence | MGKKKKQKKKPIEWRDLTINALIDLIIGIILIIIGKYIG |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 39 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3185669 | 3185788 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
2 | 811615 | 811734 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05105.14 | 1.0 | 2 | 1657.0 | same-strand | Bacteriophage holin family |
2 | PF18013.3 | 1.0 | 2 | 169.0 | same-strand | Phage tail lysozyme |
3 | PF01510.27 | 1.0 | 2 | 169.0 | same-strand | N-acetylmuramoyl-L-alanine amidase |
4 | PF01381.24 | 1.0 | 2 | 178.0 | same-strand | Helix-turn-helix |
5 | PF12844.9 | 1.0 | 2 | 178.0 | same-strand | Helix-turn-helix domain |
6 | PF13560.8 | 1.0 | 2 | 178.0 | same-strand | Helix-turn-helix domain |
7 | PF13443.8 | 1.0 | 2 | 178.0 | same-strand | Cro/C1-type HTH DNA-binding domain |
8 | PF13936.8 | 1.0 | 2 | 1172.5 | same-strand | Helix-turn-helix domain |