Result : B8DYT4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP001251.1 |
| Organism | Dictyoglomus turgidum (strain Z-1310 / DSM 6724) |
| Left | 126951 |
| Right | 127208 |
| Strand | - |
| Nucleotide Sequence | ATGCTTGCATGGGTAATTATAGCTTCTATTATTACTGCGGGATTTTCAGTAGCTCTTGTGGGTATGAATGCCACTAAAGCTCAGGGAAATGCAGCGGCAAGTGCCTTTGAAAGTGTGGCTCGTCAACCTGAAGCAGGAGACCAAATAAATAGAATGCTTCTTTTTGCCCTTGCTTTTATAGAAACCATAATGATTTTTACCTTAACTGTTGCTTTAATTCTTCTCTTTGCAAATCCACTTCTTGGAAAACTCTCTTAA |
| Sequence | MLAWVIIASIITAGFSVALVGMNATKAQGNAAASAFESVARQPEAGDQINRMLLFALAFIETIMIFTLTVALILLFANPLLGKLS |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 28066333 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | B8DYT4 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 126951 | 127208 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 2 | 1817648 | 1817902 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 3 | 2839346 | 2839573 | + | NZ_CP014476.1 | Methylomonas denitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011661.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02823.18 | 0.67 | 2 | 4537.0 | same-strand | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
| 2 | PF00006.27 | 1.0 | 3 | 2958.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 3 | PF02874.25 | 1.0 | 3 | 2779 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 4 | PF00231.21 | 1.0 | 3 | 2347 | same-strand | ATP synthase |
| 5 | PF00306.29 | 0.67 | 2 | 759.5 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 6 | PF00430.20 | 0.67 | 2 | 25.5 | same-strand | ATP synthase B/B' CF(0) |
| 7 | PF00119.22 | 1.0 | 3 | 16 | same-strand | ATP synthase A chain |
| 8 | PF09527.12 | 1.0 | 3 | 978 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 9 | PF00588.21 | 0.67 | 2 | 1200.0 | same-strand | SpoU rRNA Methylase family |
| 10 | PF09424.12 | 0.67 | 2 | 1658.0 | same-strand | Yqey-like protein |
++ More..