Protein Information |
Information Type | Description |
---|---|
Protein name | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) |
NCBI Accession ID | CP001213.1 |
Organism | Bifidobacterium animalis subsp. lactis (strain AD011) |
Left | 1481756 |
Right | 1481971 |
Strand | + |
Nucleotide Sequence | ATGCCATCTGCATCCGGACACCATCAGATCCCCGCCGAGACACAGCGGCATGATGACGACCAGACCCAGGAAACGGCCCAGGGTCTTTCCGCAGCGGCCATGCTTGCGCAGGAGCAGGCTGACGATCTCGATGCGATTCTCGATGACATCGAAACCGTTCTCGAGACGAACGCTGAGGAATATGTGAGCAGCTTCGTGCAGAAAGGCGGCGAGTGA |
Sequence | MPSASGHHQIPAETQRHDDDQTQETAQGLSAAAMLAQEQADDLDAILDDIETVLETNAEEYVSSFVQKGGE |
Source of smORF | Swiss-Prot |
Function | Protein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. {ECO:0000255|HAMAP-Rule:MF_02106}. |
Pubmed ID | 19011029 |
Domain | CDD:391659 |
Functional Category | Others |
Uniprot ID | B8DTX7 |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 869087 | 869305 | + | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
2 | 1378329 | 1378523 | - | NZ_LT985188.1 | Micropruina glycogenica |
3 | 1761334 | 1761528 | + | NZ_CP045737.1 | Aeromicrobium yanjiei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03136.17 | 0.67 | 2 | 1756.5 | same-strand | Pup-ligase protein |