Result : B8DTX7

Protein Information

• Protein name: Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)
• NCBI Accession ID: CP001213.1
• Organism: Bifidobacterium animalis subsp. lactis (strain AD011)
• Left: 1481756
• Right: 1481971
• Strand: +
• Nucleotide Sequence: ATGCCATCTGCATCCGGACACCATCAGATCCCCGCCGAGACACAGCGGCATGATGACGACCAGACCCAGGAAACGGCCCAGGGTCTTTCCGCAGCGGCCATGCTTGCGCAGGAGCAGGCTGACGATCTCGATGCGATTCTCGATGACATCGAAACCGTTCTCGAGACGAACGCTGAGGAATATGTGAGCAGCTTCGTGCAGAAAGGCGGCGAGTGA
• Sequence: MPSASGHHQIPAETQRHDDDQTQETAQGLSAAAMLAQEQADDLDAILDDIETVLETNAEEYVSSFVQKGGE
• Source of smORF: Swiss-Prot
• Function: Protein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. {ECO:0000255|HAMAP-Rule:MF_02106}.
• Pubmed ID: 19011029
• Domain: CDD:391659
• Functional Category: Others
• Uniprot ID: B8DTX7
• ORF Length (Amino Acid): 71

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	869087	869305	+	NZ_AP012326.1	Bifidobacterium dentium JCM 1195 = DSM 20436
2	1378329	1378523	-	NZ_LT985188.1	Micropruina glycogenica
3	1761334	1761528	+	NZ_CP045737.1	Aeromicrobium yanjiei

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_AP012326.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03136.17	0.67	2	1756.5	same-strand	Pup-ligase protein