Result : EXP03032
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03032 |
| NCBI Accession ID | |
| Organism | Roseburia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTTTCTGGTGGCGATGCGCTTTTGGGAAACACCCGTCCACATCCCGAACACGATGGTTAAGACTGAAGCGGCCGATAATACTATCCTGGTAACGGTATGGGAAGGTAGGTGGATGCTAGATTGA |
| Sequence | MFLVAMRFWETPVHIPNTMVKTEAADNTILVTVWEGRWMLD |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 26705 | 26821 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 2 | 202632 | 202748 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 3 | 3943304 | 3943408 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 4 | 694962 | 695066 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 5 | 3562761 | 3562883 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 6 | 999217 | 999321 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 7 | 16143 | 16256 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 8 | 132051 | 132164 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 9 | 2786386 | 2786496 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 10 | 2314109 | 2314222 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 11 | 759465 | 759575 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 12 | 94089 | 94202 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 13 | 730668 | 730781 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 14 | 65574 | 65687 | + | NC_014388.1 | Butyrivibrio proteoclasticus B316 |
| 15 | 74981 | 75094 | + | NC_014388.1 | Butyrivibrio proteoclasticus B316 |
| 16 | 456144 | 456275 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 17 | 3574871 | 3574996 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 18 | 16276 | 16401 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 19 | 94555 | 94671 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 20 | 3150829 | 3150954 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 21 | 1337522 | 1337638 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 22 | 1932496 | 1932615 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 23 | 1938433 | 1938552 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 24 | 1852860 | 1852979 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 25 | 1002265 | 1002384 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 26 | 1312305 | 1312409 | + | NZ_CP039126.1 | Blautia producta |
| 27 | 50930 | 51052 | + | NZ_HG917868.1 | Clostridium bornimense |
| 28 | 2701081 | 2701200 | - | NZ_HG917868.1 | Clostridium bornimense |
| 29 | 296754 | 296873 | + | NZ_HG917868.1 | Clostridium bornimense |
| 30 | 1455456 | 1455575 | - | NZ_HG917868.1 | Clostridium bornimense |
| 31 | 3029020 | 3029148 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 32 | 77217 | 77339 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 33 | 687816 | 687926 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036345.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01128.21 | 0.67 | 6 | 2407.0 | same-strand | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
| 2 | PF00814.27 | 0.67 | 6 | 3293 | same-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 3 | PF00005.29 | 0.67 | 6 | 5031.0 | same-strand | ABC transporter |
++ More..