Result : EXP03030
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03030 |
| NCBI Accession ID | |
| Organism | Roseburia,Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGATTTCGAGGCAGAATTAGAAAAATTTCAGCCTAGTCTTGATATTGAGCAGGCGGAGGATGCCATTTATGGAAACAGTACAACCGATGTGATGGATCTGCTCCAGAGTATTCTGGCAGATGTGAATACAGGCTCAAAGAAAGCAGAATAG |
| Sequence | MDFEAELEKFQPSLDIEQAEDAIYGNSTTDVMDLLQSILADVNTGSKKAE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 737649 | 737792 | + | NZ_LR699011.1 | Roseburia hominis |
| 2 | 1664609 | 1664752 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 3 | 2158596 | 2158730 | - | NZ_LN879430.1 | Herbinix luporum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699011.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07719.19 | 1.0 | 3 | 37 | same-strand | Tetratricopeptide repeat |
| 2 | PF13432.8 | 0.67 | 2 | 38.0 | same-strand | Tetratricopeptide repeat |
| 3 | PF01740.23 | 1.0 | 3 | 1581 | same-strand | STAS domain |
| 4 | PF13466.8 | 1.0 | 3 | 1581 | same-strand | STAS domain |
| 5 | PF13581.8 | 1.0 | 3 | 1929 | same-strand | Histidine kinase-like ATPase domain |
| 6 | PF02518.28 | 1.0 | 3 | 1929 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF04542.16 | 1.0 | 3 | 2373 | same-strand | Sigma-70 region 2 |
| 8 | PF04545.18 | 1.0 | 3 | 2373 | same-strand | Sigma-70, region 4 |
++ More..