Result : EXP03019
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03019 |
| NCBI Accession ID | |
| Organism | Parabacteroides,Bacteroides,Prevotella,Odoribacter,Gabonia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGTGATTATAGCGACAGGGAATACACCTCTTCCCATTCCGAACAGAGAAGTGAAGACTGTTTGCGCCGATGGTACTGCAATTTGCGGAAGAGTAGGTAATTGCCAAAGAGAGATCAACTAA |
| Sequence | MVIIATGNTPLPIPNREVKTVCADGTAICGRVGNCQREIN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 996536 | 996667 | + | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 2 | 1428694 | 1428825 | + | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 3 | 2056996 | 2057139 | + | NZ_CP023777.1 | Chitinophaga caeni |
| 4 | 3835985 | 3836110 | + | NZ_LR134289.1 | Chryseobacterium gleum |
| 5 | 2037549 | 2037671 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 6 | 2628112 | 2628234 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 7 | 607757 | 607879 | + | NZ_CP009249.1 | Corynebacterium phocae |
++ More..