Result : EXP03016
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03016 |
| NCBI Accession ID | |
| Organism | Clostridium,Oscillibacter,Subdoligranulum |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAAAAATGGAACTGCTCTGTCTGTGGTTACATCCACGAAGGCCCCCTGCCAGCCGATTTTGTCTGCCCCGTATGCAAACACCCGCAGAGCTACTTTGAGCTGCACAAAGAAAATTATTGA |
| Sequence | MEKWNCSVCGYIHEGPLPADFVCPVCKHPQSYFELHKENY |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID | 32601270 |
| Domain | CDD:412217 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 104
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2942166 | 2942279 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 2 | 1510180 | 1510293 | + | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 3 | 1366744 | 1366845 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 4 | 2415487 | 2415600 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 5 | 1077918 | 1078034 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 6 | 58173 | 58286 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 7 | 697868 | 697969 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 8 | 2427838 | 2427939 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 9 | 2016910 | 2017017 | - | NZ_CP014176.1 | Clostridium argentinense |
| 10 | 2893739 | 2893852 | - | NZ_CP048649.1 | Aminipila butyrica |
| 11 | 1754514 | 1754627 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 12 | 1976895 | 1977002 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 13 | 1159264 | 1159365 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 14 | 771093 | 771209 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 15 | 2618607 | 2618726 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 16 | 766428 | 766565 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 17 | 177621 | 177752 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 18 | 1964843 | 1964956 | - | NC_014363.1 | Olsenella uli DSM 7084 |
| 19 | 2346791 | 2346907 | + | NC_009712.1 | Methanoregula boonei 6A8 |
| 20 | 106366 | 106503 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 21 | 3219823 | 3219924 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 22 | 1846372 | 1846485 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 23 | 2117030 | 2117146 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 24 | 5352165 | 5352281 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 25 | 1040211 | 1040318 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 26 | 2691919 | 2692035 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 27 | 2229481 | 2229588 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 28 | 957659 | 957775 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 29 | 150814 | 150930 | + | NC_015416.1 | Methanothrix soehngenii GP6 |
| 30 | 1252068 | 1252181 | - | NZ_CP007451.1 | Draconibacterium orientale |
| 31 | 4335834 | 4335950 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 32 | 2355432 | 2355545 | - | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 33 | 2287333 | 2287470 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 34 | 1193232 | 1193369 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 35 | 2837676 | 2837807 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 36 | 4861527 | 4861664 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 37 | 132633 | 132749 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 38 | 4118269 | 4118385 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 39 | 785628 | 785741 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 40 | 2786837 | 2786950 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 41 | 2019745 | 2019858 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 42 | 692767 | 692871 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 43 | 1367338 | 1367457 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 44 | 703513 | 703626 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 45 | 2824603 | 2824716 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 46 | 2287682 | 2287795 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 47 | 1718400 | 1718507 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 48 | 2687142 | 2687258 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 49 | 6138620 | 6138733 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 50 | 423718 | 423840 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 51 | 198502 | 198615 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 52 | 1535685 | 1535792 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 53 | 3539607 | 3539720 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 54 | 763146 | 763259 | + | NZ_CP020953.1 | Clostridium drakei |
| 55 | 2150433 | 2150546 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 56 | 6610876 | 6610989 | + | NZ_CP061800.1 | Desulfonema magnum |
| 57 | 6827352 | 6827468 | - | NZ_CP061800.1 | Desulfonema magnum |
| 58 | 548778 | 548891 | - | NZ_CP030776.1 | Clostridium butyricum |
| 59 | 1901759 | 1901866 | - | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 60 | 916927 | 917028 | - | NZ_HG917868.1 | Clostridium bornimense |
| 61 | 78653 | 78754 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 62 | 2096210 | 2096308 | - | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 63 | 101936 | 102037 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 64 | 401681 | 401797 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 65 | 1252180 | 1252311 | - | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 66 | 1375002 | 1375118 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 67 | 3239902 | 3240039 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 68 | 3154407 | 3154520 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 69 | 171106 | 171219 | + | NZ_AP019367.1 | Parolsenella catena |
| 70 | 555383 | 555493 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 71 | 1894493 | 1894606 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 72 | 2626503 | 2626619 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 73 | 1419388 | 1419501 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 74 | 412549 | 412662 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 75 | 1782060 | 1782170 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 76 | 1627058 | 1627180 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 77 | 2637836 | 2637952 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 78 | 4185487 | 4185603 | + | NZ_CP028897.1 | Dongshaea marina |
| 79 | 542839 | 542943 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 80 | 4486062 | 4486175 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 81 | 1280929 | 1281048 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 82 | 151869 | 151982 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 83 | 1582384 | 1582491 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 84 | 1210335 | 1210448 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 85 | 941657 | 941770 | + | NZ_LS974202.1 | Mesotoga infera |
| 86 | 56882 | 56995 | + | NZ_CP040882.1 | Sutterella faecalis |
| 87 | 931272 | 931379 | - | NZ_CP023671.1 | Clostridium septicum |
| 88 | 4407751 | 4407867 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 89 | 2805376 | 2805504 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 90 | 526007 | 526120 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 91 | 1223590 | 1223703 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 92 | 3272872 | 3272985 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 93 | 5220 | 5333 | + | NZ_LT635455.1 | Olsenella timonensis |
| 94 | 2462040 | 2462156 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 95 | 4970305 | 4970421 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 96 | 3781652 | 3781765 | + | NZ_CP040924.1 | Clostridium thermarum |
| 97 | 2272952 | 2273089 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 98 | 1495985 | 1496122 | - | NC_007796.1 | Methanospirillum hungatei JF-1 |
| 99 | 1247840 | 1247953 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 100 | 3612080 | 3612190 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 101 | 513356 | 513469 | - | NZ_CP010070.1 | Candidatus Methanoplasma termitum |
| 102 | 2366718 | 2366819 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 103 | 929746 | 929883 | + | NC_015216.1 | Methanobacterium lacus |
| 104 | 3647255 | 3647365 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 105 | 2875926 | 2876036 | + | NC_013665.1 | Methanocella paludicola SANAE |
| 106 | 1809106 | 1809204 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 107 | 1677464 | 1677562 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 108 | 1336371 | 1336469 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
++ More..