Result : B8DNP8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP001197.1 |
| Organism | Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) |
| Left | 160936 |
| Right | 161139 |
| Strand | - |
| Nucleotide Sequence | ATGTTCGGTATCGGCATTCAGGAATTGTTGGTCGTTCTCGTTCTGGTCCTGCTGGTATTCGGGGCCAACAAGCTGCCCGAAATCGGCGGCGGGCTCGGGCGTGCCATCCGGAACTTCAAGCGGGCCACCAGCGAGCCCGATGAAATCGACATCACTCCGGGCAAGAAGAACGGCAAGACCGACAAGGACGACAAGCAGGCATAA |
| Sequence | MFGIGIQELLVVLVLVLLVFGANKLPEIGGGLGRAIRNFKRATSEPDEIDITPGKKNGKTDKDDKQA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | B8DNP8 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 457652 | 457849 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 2 | 1003550 | 1003759 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 3 | 1923600 | 1923839 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 4 | 3305663 | 3305869 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 5 | 2389638 | 2389835 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 6 | 2448482 | 2448679 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 7 | 1874298 | 1874522 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 8 | 2510791 | 2511018 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 9 | 487580 | 487771 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 10 | 469974 | 470171 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 11 | 2601781 | 2601969 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 12 | 1814043 | 1814234 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 13 | 2217883 | 2218071 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 14 | 2428228 | 2428422 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 15 | 575036 | 575209 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 16 | 2639801 | 2639986 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 17 | 3186802 | 3186966 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 18 | 346156 | 346326 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 19 | 1637790 | 1637996 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 20 | 45013 | 45243 | + | NZ_CP045505.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 21 | 1349897 | 1350088 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 22 | 399304 | 399504 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 23 | 3388129 | 3388314 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 24 | 1807846 | 1808016 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 25 | 3617404 | 3617589 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 26 | 1183845 | 1184027 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 27 | 179254 | 179445 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 28 | 3517665 | 3517862 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 29 | 3496469 | 3496660 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 30 | 1027655 | 1027837 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 31 | 3242794 | 3242985 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 32 | 349797 | 349988 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 33 | 1778911 | 1779093 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 34 | 169979 | 170170 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 35 | 1338234 | 1338431 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 36 | 984951 | 985166 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 37 | 1580974 | 1581198 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 38 | 590662 | 590856 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 39 | 1639187 | 1639381 | - | NZ_CP021255.1 | Desulfobulbus oralis |
++ More..