Result : EXP03011
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03011 |
| NCBI Accession ID | |
| Organism | Eubacterium,Roseburia,Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTTTTTTCTTATAGCGAAGGATAATGAATGGGCTGGATTGCTTAGTAGTCTGGATATGTTTTCTGATGATTTTATGGAAGAAGGACGGATACAGCCTGAAGTACAGGTAAGGGAAGATTTTTAA |
| Sequence | MFFLIAKDNEWAGLLSSLDMFSDDFMEEGRIQPEVQVREDF |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4422683 | 4422805 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 2 | 5957506 | 5957643 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 3170032 | 3170145 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 4 | 4502109 | 4502222 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 5 | 2457460 | 2457573 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 6 | 2016442 | 2016555 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 7 | 386213 | 386329 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP021876.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.71 | 5 | 0 | same-strand | PIN domain |
++ More..