Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03011 |
NCBI Accession ID | |
Organism | Eubacterium,Roseburia,Clostridium |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGTTTTTTCTTATAGCGAAGGATAATGAATGGGCTGGATTGCTTAGTAGTCTGGATATGTTTTCTGATGATTTTATGGAAGAAGGACGGATACAGCCTGAAGTACAGGTAAGGGAAGATTTTTAA |
Sequence | MFFLIAKDNEWAGLLSSLDMFSDDFMEEGRIQPEVQVREDF |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4422683 | 4422805 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
2 | 5957506 | 5957643 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
3 | 3170032 | 3170145 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
4 | 4502109 | 4502222 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
5 | 2457460 | 2457573 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
6 | 2016442 | 2016555 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
7 | 386213 | 386329 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.71 | 5 | 0 | same-strand | PIN domain |