Result : B8DJU4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP-dependent Clp protease adapter protein ClpS |
| NCBI Accession ID | CP001197.1 |
| Organism | Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) |
| Left | 539283 |
| Right | 539585 |
| Strand | - |
| Nucleotide Sequence | ATGCCCGATGGCGGCAGGGACACGGAGCTCCTCATCGAGGACGAGGTGCGCGAGCCCCGGATGTTCCGGGTGCTGCTGCACAACGACGACTACACGACCATGGAGTTCGTGGTGTCGATCCTGATCGAGGTGTTCCGCAGAACGCCCGACGAGGCGACGCGCATCATGCTGGCCGTCCACGAGAAGGGCGTCGGCGAATGCGGAGTGTACACGGCAGAGGTGGCCGAAACCAAGGTCGCCCTCGTGCATGCCCGCGCCCGGCGCGAAGGCTATCCACTGCGCTGCACCCTCGAAGAGGTATGA |
| Sequence | MPDGGRDTELLIEDEVREPRMFRVLLHNDDYTTMEFVVSILIEVFRRTPDEATRIMLAVHEKGVGECGVYTAEVAETKVALVHARARREGYPLRCTLEEV |
| Source of smORF | Swiss-Prot |
| Function | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Pubmed ID | |
| Domain | CDD:412656 |
| Functional Category | Others |
| Uniprot ID | B8DJU4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 476
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1900039 | 1900281 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 2 | 2150774 | 2151088 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 3 | 2003786 | 2004094 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 4 | 1070844 | 1071158 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 5 | 3196711 | 3197025 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 6 | 2393436 | 2393693 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 7 | 1851503 | 1851778 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 8 | 56834 | 57076 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 9 | 1106131 | 1106406 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 10 | 1973610 | 1973882 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 11 | 762043 | 762291 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 12 | 3261788 | 3262102 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 13 | 218654 | 218896 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 14 | 314558 | 314872 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 15 | 911998 | 912312 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 16 | 1595319 | 1595624 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 17 | 835526 | 835837 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 18 | 133049 | 133291 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 19 | 2148805 | 2149047 | + | NZ_CP061800.1 | Desulfonema magnum |
| 20 | 154468 | 154782 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 21 | 2000429 | 2000704 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 22 | 2597116 | 2597418 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 23 | 2661599 | 2661901 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 24 | 186905 | 187147 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 25 | 1214521 | 1214829 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 26 | 3197514 | 3197831 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 27 | 2698644 | 2698886 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 28 | 1313685 | 1314005 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 29 | 2844002 | 2844316 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 30 | 4150431 | 4150673 | - | NZ_CP061799.1 | Desulfonema limicola |
| 31 | 1142546 | 1142788 | - | NZ_CP071057.1 | Marinicauda algicola |
| 32 | 1888007 | 1888249 | - | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 33 | 575605 | 575886 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 34 | 1833365 | 1833610 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 35 | 4612063 | 4612329 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 36 | 3010756 | 3011013 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 37 | 140496 | 140738 | - | NZ_CP014525.1 | Haematospirillum jordaniae |
| 38 | 2693869 | 2694111 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 39 | 1741318 | 1741560 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 40 | 2914079 | 2914387 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 41 | 2319031 | 2319360 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 42 | 398440 | 398754 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 43 | 997724 | 997966 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 44 | 1505853 | 1506170 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 45 | 828451 | 828693 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 46 | 2179525 | 2179767 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 47 | 1670934 | 1671230 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 48 | 1398337 | 1398669 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 49 | 4557755 | 4558096 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 50 | 703093 | 703392 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 51 | 3043838 | 3044080 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 52 | 1248647 | 1248928 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 53 | 1855584 | 1855826 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 54 | 1850314 | 1850643 | + | NZ_CP016268.1 | Woeseia oceani |
| 55 | 1482529 | 1482771 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 56 | 1304146 | 1304388 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 57 | 838710 | 838988 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 58 | 1037293 | 1037610 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 59 | 1148535 | 1148813 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 60 | 1149644 | 1149922 | - | NC_004310.3 | Brucella suis 1330 |
| 61 | 1152252 | 1152530 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 62 | 1155197 | 1155475 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 63 | 838923 | 839201 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 64 | 1164156 | 1164434 | - | NC_007618.1 | Brucella abortus 2308 |
| 65 | 1557627 | 1557905 | + | NZ_LT605585.1 | Brucella inopinata |
| 66 | 4192893 | 4193135 | - | NZ_CP046052.1 | Methylocystis heyeri |
| 67 | 2816819 | 2817148 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 68 | 2449052 | 2449294 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 69 | 1061886 | 1062128 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 70 | 6441059 | 6441394 | + | NZ_CP039690.1 | Phreatobacter stygius |
| 71 | 1469821 | 1470120 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 72 | 1345630 | 1345959 | + | NZ_AP018907.1 | Blastochloris tepida |
| 73 | 3856904 | 3857146 | + | NZ_CP044331.1 | Methylocystis parvus |
| 74 | 2376897 | 2377160 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 75 | 1330886 | 1331215 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 76 | 2149181 | 2149459 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 77 | 1383639 | 1383968 | - | NZ_CP064063.1 | Brucella anthropi |
| 78 | 2826522 | 2826848 | - | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 79 | 1771058 | 1771402 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 80 | 3763129 | 3763371 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 81 | 1282520 | 1282762 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 82 | 1295293 | 1295625 | + | NZ_CP054836.1 | Oricola thermophila |
| 83 | 3750259 | 3750579 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 84 | 1095853 | 1096095 | + | NZ_CP019875.1 | Komagataeibacter nataicola |
| 85 | 3100815 | 3101099 | - | NZ_LR134201.1 | Cedecea lapagei |
| 86 | 3078121 | 3078468 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 87 | 2149787 | 2150029 | + | NZ_CP060244.1 | Entomobacter blattae |
| 88 | 1970303 | 1970584 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 89 | 2445285 | 2445530 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 90 | 3060076 | 3060396 | - | NZ_LS483422.1 | Providencia heimbachae |
| 91 | 2172367 | 2172624 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 92 | 1629722 | 1630021 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 93 | 2228547 | 2228816 | + | NZ_CP013002.1 | Caulobacter henricii |
| 94 | 981834 | 982076 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 95 | 2968702 | 2968944 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 96 | 2250433 | 2250675 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 97 | 1224106 | 1224438 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 98 | 8569131 | 8569454 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 99 | 3182531 | 3182800 | - | NZ_CP048796.1 | Providencia vermicola |
| 100 | 1443716 | 1444048 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 101 | 3128468 | 3128746 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 102 | 3183281 | 3183523 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 103 | 434693 | 435040 | + | NZ_CP032485.1 | Neokomagataea tanensis |
| 104 | 372123 | 372365 | + | NZ_CP038469.1 | Citrobacter tructae |
| 105 | 2527404 | 2527646 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 106 | 278264 | 278506 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 107 | 685372 | 685701 | - | NC_015161.1 | Deinococcus proteolyticus MRP |
| 108 | 3064334 | 3064603 | + | NZ_CP027850.1 | Caulobacter segnis |
| 109 | 1550645 | 1550902 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 110 | 298317 | 298673 | - | NZ_CP014681.1 | Kozakia baliensis |
| 111 | 1030673 | 1030915 | - | NZ_CP053708.1 | Lichenicola cladoniae |
| 112 | 3457391 | 3457633 | + | NZ_CP053416.1 | Salmonella bongori |
| 113 | 4185693 | 4185935 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 114 | 877255 | 877497 | - | NZ_CP033744.1 | Citrobacter freundii |
| 115 | 1022428 | 1022670 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 116 | 1931704 | 1931946 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 117 | 2222928 | 2223185 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 118 | 3680633 | 3680875 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 119 | 77368 | 77625 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 120 | 1497586 | 1497831 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 121 | 2022230 | 2022529 | - | NZ_CP040924.1 | Clostridium thermarum |
| 122 | 2237289 | 2237546 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 123 | 1597018 | 1597260 | + | NZ_CP012946.1 | Blastochloris viridis |
| 124 | 2699517 | 2699786 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 125 | 1985966 | 1986208 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 126 | 770720 | 770962 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 127 | 2029703 | 2029972 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 128 | 426943 | 427242 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 129 | 277878 | 278177 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 130 | 759236 | 759511 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 131 | 453044 | 453286 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 132 | 1282788 | 1283030 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 133 | 5023978 | 5024247 | + | NZ_CP026100.1 | Caulobacter flavus |
| 134 | 1582715 | 1582957 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 135 | 1506974 | 1507216 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 136 | 4072062 | 4072304 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 137 | 406047 | 406346 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 138 | 2039247 | 2039489 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 139 | 523655 | 523960 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 140 | 1885932 | 1886174 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 141 | 2635442 | 2635684 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 142 | 1507593 | 1507835 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 143 | 1551705 | 1551947 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 144 | 2164501 | 2164758 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 145 | 276922 | 277197 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 146 | 2061382 | 2061705 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 147 | 1429634 | 1429876 | + | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 148 | 286837 | 287079 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 149 | 3827747 | 3828106 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 150 | 6199180 | 6199503 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 151 | 2156594 | 2156839 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 152 | 3041331 | 3041681 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 153 | 3421710 | 3421952 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 154 | 1846693 | 1846935 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 155 | 3675193 | 3675435 | - | NZ_CP054254.1 | Klebsiella variicola |
| 156 | 332950 | 333255 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 157 | 2087651 | 2087965 | + | NZ_CP022278.1 | Neisseria chenwenguii |
| 158 | 3458287 | 3458529 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 159 | 2206729 | 2206986 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 160 | 861755 | 861997 | + | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 161 | 2064198 | 2064440 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 162 | 290922 | 291164 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 163 | 1851212 | 1851454 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 164 | 2283979 | 2284221 | - | NZ_CP015164.1 | Acetobacter ascendens |
| 165 | 2625927 | 2626208 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 166 | 1670162 | 1670404 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 167 | 1559685 | 1559927 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 168 | 3914202 | 3914528 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 169 | 1626607 | 1626852 | + | NZ_CP050150.1 | Hafnia alvei |
| 170 | 2073057 | 2073362 | + | NZ_CP031252.1 | Neisseria elongata |
| 171 | 1513476 | 1513718 | + | NC_015968.1 | Enterobacter soli |
| 172 | 3526240 | 3526482 | - | NZ_CP041247.1 | Raoultella electrica |
| 173 | 3552883 | 3553125 | + | NZ_CP026047.1 | Raoultella planticola |
| 174 | 3696703 | 3696945 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 175 | 513142 | 513384 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 176 | 994150 | 994392 | + | NZ_CP053856.1 | Rhizobium pusense |
| 177 | 997640 | 997882 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 178 | 737524 | 737766 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 179 | 3315132 | 3315374 | - | NZ_CP023525.1 | Cedecea neteri |
| 180 | 3810645 | 3810887 | - | NZ_CP050508.1 | Raoultella terrigena |
| 181 | 2219215 | 2219532 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
| 182 | 2443294 | 2443593 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 183 | 3903990 | 3904232 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 184 | 398805 | 399107 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 185 | 2022415 | 2022753 | + | NZ_CP020083.1 | Blastomonas fulva |
| 186 | 2333900 | 2334178 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 187 | 1656908 | 1657240 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 188 | 4304771 | 4305055 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 189 | 1959504 | 1959797 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 190 | 2512849 | 2513091 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 191 | 1680896 | 1681138 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 192 | 4504551 | 4504793 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 193 | 3641349 | 3641630 | - | NZ_CP010803.1 | Martelella endophytica |
| 194 | 4954610 | 4954933 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 195 | 1554112 | 1554411 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 196 | 3203231 | 3203473 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 197 | 3024853 | 3025095 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 198 | 656922 | 657164 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 199 | 3307169 | 3307411 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 200 | 1599491 | 1599823 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 201 | 751442 | 751687 | - | NC_016025.1 | Chloracidobacterium thermophilum B |
| 202 | 1201802 | 1202104 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 203 | 3976590 | 3976832 | - | NZ_CP030265.1 | Skermanella pratensis |
| 204 | 1628068 | 1628310 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 205 | 4826526 | 4826858 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 206 | 1238796 | 1239038 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 207 | 1283219 | 1283461 | + | NZ_CP013236.1 | Collimonas pratensis |
| 208 | 2588929 | 2589171 | - | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 209 | 2121139 | 2121426 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 210 | 2819418 | 2819660 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 211 | 108920 | 109234 | - | NZ_CP022355.1 | Paraphotobacterium marinum |
| 212 | 747619 | 747861 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 213 | 893702 | 893944 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 214 | 2972088 | 2972330 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 215 | 4081251 | 4081493 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 216 | 4558173 | 4558415 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 217 | 1748549 | 1748791 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 218 | 1730710 | 1731045 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 219 | 1564703 | 1564945 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 220 | 1545257 | 1545499 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 221 | 1515688 | 1515930 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 222 | 1001846 | 1002088 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 223 | 1574923 | 1575165 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 224 | 733634 | 733876 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 225 | 1907814 | 1908056 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 226 | 2612031 | 2612273 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 227 | 1124354 | 1124596 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 228 | 807651 | 807962 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 229 | 1419795 | 1420037 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 230 | 874304 | 874546 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 231 | 922991 | 923233 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 232 | 1819179 | 1819436 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 233 | 1054067 | 1054309 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 234 | 3137635 | 3137877 | - | NZ_CP031555.1 | Thalassospira indica |
| 235 | 2518876 | 2519184 | + | NZ_CP026328.2 | Acidithiobacillus caldus |
| 236 | 210843 | 211085 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 237 | 948192 | 948434 | + | NZ_AP014857.1 | Escherichia albertii |
| 238 | 1646427 | 1646669 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 239 | 2333601 | 2333918 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 240 | 1137964 | 1138206 | + | NZ_CP013235.1 | Collimonas arenae |
| 241 | 4269970 | 4270212 | - | NZ_CP013232.1 | Collimonas fungivorans |
| 242 | 298605 | 298847 | - | NZ_CP068286.1 | Ralstonia syzygii subsp. celebesensis |
| 243 | 951995 | 952237 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 244 | 1076574 | 1076816 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 245 | 2794316 | 2794558 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 246 | 2971201 | 2971443 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 247 | 3567519 | 3567761 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 248 | 1870853 | 1871152 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 249 | 450636 | 450878 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 250 | 3235213 | 3235455 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 251 | 1650930 | 1651172 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 252 | 456880 | 457122 | - | NZ_CP029829.1 | Azospirillum ramasamyi |
| 253 | 2383902 | 2384144 | + | NZ_CP054619.1 | Azospirillum oryzae |
| 254 | 979142 | 979411 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 255 | 739735 | 739977 | - | NZ_CP021081.1 | Deinococcus ficus |
| 256 | 2260049 | 2260291 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 257 | 1392826 | 1393068 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 258 | 1076814 | 1077122 | + | NZ_CP009056.1 | Frischella perrara |
| 259 | 1571964 | 1572206 | + | NZ_LR134340.1 | Escherichia marmotae |
| 260 | 2622866 | 2623108 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 261 | 380528 | 380770 | + | NZ_CP067057.1 | Rahnella aceris |
| 262 | 2541068 | 2541310 | - | NZ_CP024199.1 | Thalassospira marina |
| 263 | 3715563 | 3715805 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 264 | 2293317 | 2293559 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 265 | 3183724 | 3183993 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 266 | 3914856 | 3915125 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 267 | 2071057 | 2071371 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 268 | 3493841 | 3494083 | - | NZ_CP041352.1 | Casimicrobium huifangae |
| 269 | 2655085 | 2655327 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 270 | 1897907 | 1898149 | + | NZ_CP028897.1 | Dongshaea marina |
| 271 | 1054748 | 1054990 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 272 | 611535 | 611777 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 273 | 1899325 | 1899567 | - | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 274 | 1408559 | 1408801 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 275 | 2649059 | 2649340 | + | NZ_CP032509.1 | Georhizobium profundi |
| 276 | 1122475 | 1122717 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 277 | 3084639 | 3084881 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 278 | 1900015 | 1900257 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 279 | 5886395 | 5886637 | + | NZ_CP019038.1 | Massilia putida |
| 280 | 2134101 | 2134343 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 281 | 1997142 | 1997390 | + | NZ_CP016211.1 | Minicystis rosea |
| 282 | 1614464 | 1614706 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 283 | 1900669 | 1900929 | + | NZ_CP048832.1 | Janthinobacterium lividum |
| 284 | 1201721 | 1201999 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 285 | 1665059 | 1665364 | + | NZ_CP059571.1 | Neisseria bacilliformis |
| 286 | 3032763 | 3033005 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 287 | 1923724 | 1923966 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 288 | 2546152 | 2546394 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 289 | 2318037 | 2318360 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 290 | 4499691 | 4499933 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 291 | 3621820 | 3622104 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 292 | 3547093 | 3547335 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 293 | 1432661 | 1432903 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 294 | 1373499 | 1373750 | - | NZ_CP053923.1 | Defluviicoccus vanus |
| 295 | 1973129 | 1973389 | + | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 296 | 5746429 | 5746689 | + | NZ_CP041185.1 | Janthinobacterium tructae |
| 297 | 2442795 | 2443037 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 298 | 1412545 | 1412790 | + | NZ_CP015581.1 | Tatumella citrea |
| 299 | 3300552 | 3300794 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 300 | 3210429 | 3210671 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 301 | 4027471 | 4027713 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 302 | 2792215 | 2792457 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 303 | 748910 | 749152 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 304 | 215207 | 215527 | + | NZ_CP034759.1 | Litorilituus sediminis |
| 305 | 1308685 | 1308927 | - | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 306 | 76592 | 76834 | - | NZ_CP019706.1 | Pantoea alhagi |
| 307 | 1347537 | 1347794 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 308 | 2784030 | 2784272 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 309 | 2831295 | 2831537 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 310 | 520607 | 520849 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 311 | 1583726 | 1583983 | - | NZ_CP072793.1 | Thiothrix unzii |
| 312 | 1251321 | 1251563 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 313 | 1467112 | 1467393 | + | NZ_CP029210.1 | Aquabacterium olei |
| 314 | 1922423 | 1922671 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 315 | 3139154 | 3139435 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 316 | 3461210 | 3461503 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 317 | 2386173 | 2386415 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 318 | 1338759 | 1339028 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 319 | 3530079 | 3530348 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 320 | 1669290 | 1669559 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 321 | 2154177 | 2154419 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 322 | 2731467 | 2731709 | - | NZ_CP038853.1 | Pantoea vagans |
| 323 | 1754047 | 1754289 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 324 | 2357777 | 2358019 | - | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 325 | 2750406 | 2750750 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 326 | 1260538 | 1260861 | + | NZ_LN681225.1 | Legionella hackeliae |
| 327 | 3026303 | 3026545 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 328 | 2389167 | 2389424 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 329 | 1661317 | 1661580 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 330 | 3028932 | 3029189 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 331 | 1876156 | 1876404 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 332 | 3385469 | 3385750 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 333 | 446202 | 446501 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 334 | 3193938 | 3194180 | + | NZ_CP065640.1 | Serratia rubidaea |
| 335 | 3273947 | 3274189 | - | NZ_CP071320.1 | Serratia ureilytica |
| 336 | 1082585 | 1082827 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 337 | 1774909 | 1775151 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 338 | 1768173 | 1768415 | + | NZ_LR134494.1 | Serratia quinivorans |
| 339 | 1784661 | 1784903 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 340 | 3962452 | 3962694 | + | NZ_CP011254.1 | Serratia fonticola |
| 341 | 2343410 | 2343652 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 342 | 520188 | 520430 | - | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 343 | 596460 | 596702 | + | NZ_CP014782.1 | Shewanella psychrophila |
| 344 | 2519909 | 2520232 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 345 | 300184 | 300483 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 346 | 2084107 | 2084349 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 347 | 4303374 | 4303616 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 348 | 3102172 | 3102414 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 349 | 3639648 | 3639890 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 350 | 2839681 | 2839923 | + | NZ_CP026364.1 | Proteus hauseri |
| 351 | 849822 | 850100 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 352 | 1938861 | 1939103 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 353 | 1726863 | 1727135 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 354 | 1954701 | 1955024 | - | NZ_CP038254.1 | Legionella israelensis |
| 355 | 4264766 | 4265008 | + | NZ_CP049115.1 | Pantoea stewartii |
| 356 | 1657769 | 1658011 | - | NZ_CP023276.1 | Polynucleobacter difficilis |
| 357 | 2000156 | 2000398 | + | NZ_CP008849.1 | Alteromonas australica |
| 358 | 3063615 | 3063923 | - | NZ_CP030032.1 | Bradymonas sediminis |
| 359 | 564356 | 564598 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 360 | 781289 | 781531 | + | NZ_CP028271.1 | Mixta intestinalis |
| 361 | 186242 | 186499 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 362 | 1188648 | 1188890 | - | NZ_LT615228.1 | Polynucleobacter necessarius |
| 363 | 2419167 | 2419409 | - | NZ_CP037951.1 | Parashewanella tropica |
| 364 | 1445966 | 1446283 | + | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 365 | 513613 | 513855 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 366 | 1821887 | 1822129 | - | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 367 | 1946897 | 1947178 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 368 | 1889432 | 1889674 | - | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 369 | 2224907 | 2225224 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 370 | 2067873 | 2068115 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 371 | 974996 | 975283 | + | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 372 | 1539532 | 1539774 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 373 | 2263344 | 2263637 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 374 | 3703331 | 3703606 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 375 | 3052177 | 3052419 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 376 | 2152016 | 2152258 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 377 | 1946164 | 1946478 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 378 | 664872 | 665114 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 379 | 2592603 | 2592851 | - | NC_017964.1 | Advenella kashmirensis WT001 |
| 380 | 4082997 | 4083239 | + | NZ_CP034464.1 | Undibacterium parvum |
| 381 | 1816072 | 1816314 | + | NZ_LT906479.1 | Serratia ficaria |
| 382 | 2470314 | 2470628 | - | NZ_LR134365.1 | Cardiobacterium hominis |
| 383 | 1249930 | 1250187 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 384 | 3077197 | 3077466 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 385 | 1814019 | 1814267 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 386 | 2218966 | 2219208 | + | NZ_CP046378.1 | Shewanella algae |
| 387 | 849541 | 849783 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 388 | 1141667 | 1141909 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 389 | 1514521 | 1514763 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 390 | 2730765 | 2731034 | - | NZ_CP040709.1 | Inhella inkyongensis |
| 391 | 4069099 | 4069341 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 392 | 2855123 | 2855365 | - | NZ_CP046293.1 | Yersinia intermedia |
| 393 | 2536175 | 2536432 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 394 | 3293419 | 3293661 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 395 | 530107 | 530349 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 396 | 2366298 | 2366540 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 397 | 2713843 | 2714100 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 398 | 1714642 | 1714956 | + | NZ_LR134313.1 | Neisseria canis |
| 399 | 2057922 | 2058179 | + | NZ_LR134533.1 | Neisseria weaveri |
| 400 | 1939954 | 1940253 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 401 | 1695387 | 1695629 | - | NZ_CP007501.1 | Polynucleobacter duraquae |
| 402 | 2149340 | 2149606 | - | NZ_LN614830.1 | Tatlockia micdadei |
| 403 | 2255982 | 2256305 | - | NZ_CP036422.1 | Halioglobus maricola |
| 404 | 978740 | 978982 | - | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 405 | 3095778 | 3096119 | + | NZ_CP020470.1 | Rhodobacter blasticus |
| 406 | 1834243 | 1834485 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 407 | 2838824 | 2839117 | - | NZ_CP060780.1 | Sphingomonas daechungensis |
| 408 | 483943 | 484215 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 409 | 297381 | 297674 | + | NZ_CP060782.1 | Sphingomonas sediminicola |
| 410 | 1397773 | 1398015 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 411 | 1235413 | 1235655 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 412 | 4416406 | 4416648 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 413 | 1179326 | 1179589 | - | NZ_CP010401.1 | Bartonella ancashensis |
| 414 | 2121525 | 2121803 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 415 | 726460 | 726702 | + | NZ_AP019657.1 | Vibrio ponticus |
| 416 | 2075488 | 2075730 | + | NZ_LT615367.1 | Dickeya aquatica |
| 417 | 1858172 | 1858492 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 418 | 2095876 | 2096118 | + | NZ_CP025799.1 | Dickeya zeae |
| 419 | 1527148 | 1527444 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 420 | 2101929 | 2102186 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 421 | 2044268 | 2044510 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 422 | 1958513 | 1958755 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 423 | 2347101 | 2347421 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 424 | 2162724 | 2162969 | + | NZ_AP014630.1 | Acinetobacter guillouiae |
| 425 | 1622354 | 1622596 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 426 | 1725318 | 1725563 | + | NZ_CP046415.1 | Guyparkeria halophila |
| 427 | 1053098 | 1053340 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 428 | 659733 | 659975 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 429 | 1431098 | 1431340 | + | NZ_LS483470.1 | Leminorella richardii |
| 430 | 188484 | 188726 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 431 | 1282532 | 1282774 | + | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 432 | 3511592 | 3511834 | + | NZ_CP021395.1 | Bordetella hinzii |
| 433 | 1456168 | 1456467 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 434 | 943535 | 943792 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 435 | 2241750 | 2241992 | - | NC_010645.1 | Bordetella avium 197N |
| 436 | 1744601 | 1744843 | + | NZ_CP016440.1 | Bordetella pseudohinzii |
| 437 | 2794433 | 2794675 | - | NC_010170.1 | Bordetella petrii |
| 438 | 43115 | 43396 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 439 | 2177247 | 2177522 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 440 | 2582544 | 2582786 | - | NZ_CP043146.1 | Bordetella holmesii |
| 441 | 1928812 | 1929069 | + | NZ_CP029843.1 | Lysobacter maris |
| 442 | 2380622 | 2380864 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 443 | 233678 | 233920 | - | NZ_CP045073.1 | Paracoccus kondratievae |
| 444 | 3676924 | 3677175 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 445 | 1847149 | 1847391 | + | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 446 | 768573 | 768815 | + | NZ_CP035688.1 | Vibrio metoecus |
| 447 | 1164818 | 1165075 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 448 | 616106 | 616387 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 449 | 2497394 | 2497636 | + | NZ_CP038034.1 | Achromobacter insolitus |
| 450 | 2417869 | 2418111 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 451 | 1062091 | 1062333 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 452 | 2547770 | 2548012 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 453 | 3220069 | 3220347 | - | NZ_CP011129.1 | Lysobacter antibioticus |
| 454 | 5310275 | 5310517 | + | NZ_LR134302.1 | Achromobacter spanius |
| 455 | 668499 | 668741 | - | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 456 | 1829198 | 1829455 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 457 | 3495388 | 3495708 | - | NZ_CP048788.1 | Roseobacter ponti |
| 458 | 2592985 | 2593242 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 459 | 2313424 | 2313669 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 460 | 1956171 | 1956416 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 461 | 4958208 | 4958453 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 462 | 2734492 | 2734770 | + | NZ_CP023465.1 | Lysobacter capsici |
| 463 | 2576246 | 2576524 | + | NZ_CP011131.1 | Lysobacter gummosus |
| 464 | 2165388 | 2165645 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 465 | 2673740 | 2673997 | - | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 466 | 3232587 | 3232868 | + | NZ_CP060711.1 | Thermomonas brevis |
| 467 | 3347458 | 3347700 | - | NZ_CP019437.1 | Thioclava nitratireducens |
| 468 | 2552680 | 2553000 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 469 | 522260 | 522580 | + | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 470 | 3293030 | 3293272 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 471 | 1603627 | 1603869 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 472 | 3081525 | 3081782 | + | NZ_CP041730.1 | Chitinimonas arctica |
| 473 | 444869 | 445111 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 474 | 512769 | 513011 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 475 | 1149330 | 1149575 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 476 | 496893 | 497174 | + | NZ_CP016364.1 | Phaeobacter porticola |
| 477 | 1846649 | 1846906 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 478 | 2487959 | 2488210 | - | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017310.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07724.16 | 0.93 | 445 | 28 | same-strand | AAA domain (Cdc48 subfamily) |
| 2 | PF17871.3 | 0.93 | 444 | 28.0 | same-strand | AAA lid domain |
| 3 | PF00004.31 | 0.94 | 448 | 28 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF10431.11 | 0.93 | 445 | 28 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 5 | PF07728.16 | 0.94 | 446 | 28.0 | same-strand | AAA domain (dynein-related subfamily) |
| 6 | PF02861.22 | 0.93 | 442 | 28.0 | same-strand | Clp amino terminal domain, pathogenicity island component |
++ More..