Protein Information |
Information Type | Description |
---|---|
Protein name | Protein RnfH |
NCBI Accession ID | CP001158.1 |
Organism | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) |
Left | 281136 |
Right | 281435 |
Strand | - |
Nucleotide Sequence | ATGAAGATCATAAAAGTAACCGTTGTCTATGCTTTACCAAAAATTCAATATATTTGTCAGGTTGATATTGCATTAGGATCTACTGTAAAAGATGCTATTTTAGAATCAAATTTGTTAAATTTAACAAATGACGTTTCATTTCATCACAACAGAATAGGAATATACAATAAGACCGTACATTTAAAATTCAAAATCAAAGATGGAGATAGAATTGAAATTTATAGAAATTTAACTATAGATCCAAAAGAATGGAGAAGAAATAATGTTTTTTTATCAAAAAAATTAAAAAAAATATATTAA |
Sequence | MKIIKVTVVYALPKIQYICQVDIALGSTVKDAILESNLLNLTNDVSFHHNRIGIYNKTVHLKFKIKDGDRIEIYRNLTIDPKEWRRNNVFLSKKLKKIY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
Pubmed ID | 19150844 |
Domain | CDD:421700 |
Functional Category | Others |
Uniprot ID | B8D7F0 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3804974 | 3805225 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
2 | 863787 | 864077 | + | NZ_LR134201.1 | Cedecea lapagei |
3 | 269682 | 269933 | - | NZ_CP011254.1 | Serratia fonticola |
4 | 905001 | 905267 | + | NZ_CP023525.1 | Cedecea neteri |
5 | 2594740 | 2595027 | + | NZ_CP019706.1 | Pantoea alhagi |
6 | 3062377 | 3062661 | + | NZ_CP007230.1 | Yersinia similis |
7 | 3247217 | 3247483 | - | NZ_CP061511.1 | Mixta calida |
8 | 3461881 | 3462147 | - | NZ_CP026377.1 | Mixta gaviniae |
9 | 3863109 | 3863372 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
10 | 3397729 | 3397995 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
11 | 3529718 | 3529969 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
12 | 2606058 | 2606324 | - | NZ_CP028271.1 | Mixta intestinalis |
13 | 1710045 | 1710308 | - | NZ_CP009787.1 | Yersinia rohdei |
14 | 4833408 | 4833668 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
15 | 93477 | 93719 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
16 | 3191177 | 3191461 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
17 | 1089401 | 1089646 | + | NZ_CP035129.1 | Kosakonia cowanii |
18 | 3184064 | 3184339 | - | NZ_CP015581.1 | Tatumella citrea |
19 | 3101693 | 3101986 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
20 | 2501849 | 2502100 | - | NZ_CP067057.1 | Rahnella aceris |
21 | 4297455 | 4297724 | + | NZ_CP016337.1 | Kosakonia sacchari |
22 | 1081590 | 1081856 | + | NZ_AP023184.1 | Buttiauxella agrestis |
23 | 4004651 | 4004911 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
24 | 2287942 | 2288229 | - | NZ_CP023529.1 | Lelliottia amnigena |
25 | 2710632 | 2710898 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01668.20 | 1.0 | 25 | 606 | opposite-strand | SmpB protein |
2 | PF03364.22 | 1.0 | 25 | 14 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
3 | PF10604.11 | 1.0 | 25 | 14 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
4 | PF04355.15 | 1.0 | 25 | 77 | opposite-strand | SmpA / OmlA family |
5 | PF02463.21 | 1.0 | 25 | 592 | opposite-strand | RecF/RecN/SMC N terminal domain |
6 | PF13476.8 | 1.0 | 25 | 592 | opposite-strand | AAA domain |
7 | PF20143.1 | 1.0 | 25 | 2340 | opposite-strand | ATP-NAD kinase C-terminal domain |
8 | PF01025.21 | 1.0 | 25 | 3330 | same-strand | GrpE |
9 | PF01513.23 | 0.88 | 22 | 2327.5 | opposite-strand | ATP-NAD kinase N-terminal domain |