Result : EXP02991
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02991 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCAACTCCAAGCCCGCTTTCCATTTGTCTCACCAACATGGTAATCGTGTTCGCCGTTTTGATCGTGGTGCTGCTGGTGAAGCCCGCCGGCCTGCTGGGCAAGATCATGCCCGAGAAAGTGTAA |
| Sequence | MATPSPLSICLTNMVIVFAVLIVVLLVKPAGLLGKIMPEKV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 556298 | 556417 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 2 | 2688192 | 2688329 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 3 | 373103 | 373231 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 4 | 2224103 | 2224219 | + | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 5 | 288397 | 288504 | + | NZ_CP040924.1 | Clostridium thermarum |
| 6 | 472866 | 472997 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 7 | 2381305 | 2381421 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 8 | 2584643 | 2584762 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 9 | 427663 | 427782 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 10 | 535743 | 535862 | - | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 11 | 20558 | 20677 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 12 | 1269264 | 1269401 | + | NC_018664.1 | Gottschalkia acidurici 9a |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034413.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13458.8 | 1.0 | 12 | 858.5 | same-strand | Periplasmic binding protein |
| 2 | PF01094.30 | 1.0 | 12 | 858.5 | same-strand | Receptor family ligand binding region |
| 3 | PF13433.8 | 0.83 | 10 | 858.5 | same-strand | Periplasmic binding protein domain |
| 4 | PF02653.18 | 1.0 | 12 | 8 | same-strand | Branched-chain amino acid transport system / permease component |
| 5 | PF00005.29 | 1.0 | 12 | 1725 | same-strand | ABC transporter |
| 6 | PF12399.10 | 1.0 | 12 | 978 | same-strand | Branched-chain amino acid ATP-binding cassette transporter |
++ More..