Result : B8D1Z8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Citrate lyase acyl carrier protein (Citrate lyase gamma chain) |
| NCBI Accession ID | CP001098.1 |
| Organism | Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) |
| Left | 500800 |
| Right | 501084 |
| Strand | + |
| Nucleotide Sequence | ATGGAAATTAAGAGAACTGCAAGTGCCGGAACAATGGAATCATCAGATATAATGATAACTGTAAAACCGTCAAATAATGGTATAAAAATTGAACTTAAAAGTGATGTAGAAAAACAATTTGGGAATCAGGTCAAAAAAATTATTAAAAATACTATAGAGGGGATGGGGGTAAAAAATGTGTATATTCGTGCTCAGGATAGAGGAGCACTGGATTATGCAATAAAGGCAAGAACCAGGACAGCCCTGGAGAGGGCCAGCAAGGGGGCTGAAGAGATTGAAAAATAA |
| Sequence | MEIKRTASAGTMESSDIMITVKPSNNGIKIELKSDVEKQFGNQVKKIIKNTIEGMGVKNVYIRAQDRGALDYAIKARTRTALERASKGAEEIEK |
| Source of smORF | Swiss-Prot |
| Function | Covalent carrier of the coenzyme of citrate lyase. {ECO:0000255|HAMAP-Rule:MF_00805}. |
| Pubmed ID | 19145256 |
| Domain | CDD:414649 |
| Functional Category | Others |
| Uniprot ID | B8D1Z8 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 500800 | 501084 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 2 | 1811828 | 1812133 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 3 | 898916 | 899158 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 4 | 643949 | 644257 | - | NZ_CP013237.1 | Streptococcus mutans |
| 5 | 1420158 | 1420430 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 6 | 1011716 | 1012024 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 7 | 6043423 | 6043695 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 8 | 846145 | 846441 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 9 | 472840 | 473133 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 10 | 1272121 | 1272414 | - | NZ_CP031513.1 | Bombilactobacillus bombi |
| 11 | 597813 | 598103 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 12 | 3966064 | 3966327 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 13 | 1699538 | 1699843 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 14 | 1485882 | 1486187 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 15 | 676370 | 676663 | + | NC_015389.1 | Coriobacterium glomerans PW2 |
| 16 | 395020 | 395292 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 17 | 251480 | 251773 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 18 | 1747454 | 1747762 | - | NZ_CP043405.1 | Streptococcus ratti |
| 19 | 3642449 | 3642712 | - | NZ_CP009687.1 | Clostridium aceticum |
| 20 | 5261310 | 5261573 | - | NZ_CP020953.1 | Clostridium drakei |
| 21 | 748240 | 748533 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 22 | 1120222 | 1120512 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 23 | 4410822 | 4411085 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 24 | 3789968 | 3790267 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 25 | 3381711 | 3381974 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 26 | 371489 | 371782 | + | NZ_CP014324.1 | Oenococcus oeni |
| 27 | 4662630 | 4662893 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 28 | 1218386 | 1218679 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 29 | 911443 | 911751 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 30 | 994008 | 994316 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 31 | 2377832 | 2378125 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 32 | 2045990 | 2046253 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 33 | 664281 | 664577 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 34 | 1138985 | 1139281 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 35 | 2659620 | 2659883 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 36 | 4413220 | 4413483 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 37 | 3372406 | 3372702 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 38 | 2810094 | 2810390 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 39 | 213266 | 213559 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 40 | 1331358 | 1331666 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 41 | 1238696 | 1239010 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 42 | 1247288 | 1247581 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 43 | 688099 | 688371 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 44 | 835255 | 835563 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 45 | 765258 | 765554 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 46 | 612720 | 613013 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 47 | 893566 | 893859 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 48 | 3942647 | 3942922 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 49 | 1323938 | 1324231 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 50 | 862384 | 862677 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 51 | 1813980 | 1814285 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 52 | 4805639 | 4805935 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 53 | 4047212 | 4047508 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 54 | 1801522 | 1801827 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 55 | 2238909 | 2239172 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 56 | 678450 | 678713 | + | NZ_CP014176.1 | Clostridium argentinense |
| 57 | 1853922 | 1854230 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 58 | 1788869 | 1789162 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 59 | 2803858 | 2804148 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 60 | 3835170 | 3835466 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 61 | 2384288 | 2384596 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 62 | 5470245 | 5470475 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 63 | 1237211 | 1237519 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 64 | 1652793 | 1653086 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 65 | 325183 | 325476 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 66 | 4442194 | 4442457 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 67 | 1233572 | 1233868 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 68 | 2364451 | 2364741 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 69 | 1516381 | 1516677 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 70 | 1183702 | 1183932 | + | NZ_CP036259.1 | Sporomusa termitida |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011899.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08218.13 | 0.76 | 47 | 7 | same-strand | Citrate lyase ligase C-terminal domain |
| 2 | PF03328.16 | 1.0 | 62 | 0.0 | same-strand | HpcH/HpaI aldolase/citrate lyase family |
| 3 | PF04223.14 | 1.0 | 62 | 895.0 | same-strand | Citrate lyase, alpha subunit (CitF) |
| 4 | PF03802.16 | 0.77 | 48 | 2452.5 | same-strand | Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase |
++ More..