Result : EXP02980
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02980 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGTGGAATTGGTAGACACGATGGACTTAAAATCCATTCGTCCGAAAGGACGGTGCAGGTTCGACTCCTGTTTGCGGCACAATGACATAAGTCAACAAGAGTTCTTTGAAATATACCAAACTTAA |
| Sequence | MVELVDTMDLKSIRPKGRCRFDSCLRHNDISQQEFFEIYQT |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1496984 | 1497103 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 2 | 1821003 | 1821122 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 3 | 1612621 | 1612740 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 4 | 1615272 | 1615391 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 5 | 610577 | 610696 | - | NZ_CP063079.1 | Campylobacter peloridis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053825.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12804.9 | 1.0 | 5 | 4694 | opposite-strand | MobA-like NTP transferase domain |
| 2 | PF03553.16 | 1.0 | 5 | 2061 | same-strand | Na+/H+ antiporter family |
| 3 | PF13726.8 | 1.0 | 5 | 2061 | same-strand | Na+-H+ antiporter family |
| 4 | PF00920.23 | 1.0 | 5 | 250 | opposite-strand | Dehydratase family |
| 5 | PF11396.10 | 1.0 | 5 | 2270 | same-strand | Putative beta-lactamase-inhibitor-like, PepSY-like |
| 6 | PF00004.31 | 1.0 | 5 | 2752 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF02253.17 | 0.6 | 3 | 3838 | opposite-strand | Phospholipase A1 |
| 8 | PF04461.15 | 0.6 | 3 | 4942 | same-strand | Protein of unknown function (DUF520) |
++ More..