Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02976 |
NCBI Accession ID | |
Organism | Christensenella |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGATGCAATTTCAGGTTCCCTCCAGCTTATGTGGCAGGGGATGGTCTCGATCTTTGTGGTAATCGCCGCAATTTGCGTAGCGGTTCTCGTTATTAATAAGGTAACAAGAAGGAAGAAGCAATAG |
Sequence | MDAISGSLQLMWQGMVSIFVVIAAICVAVLVINKVTRRKKQ |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1002797 | 1002922 | - | NZ_CP029256.1 | Christensenella minuta |
2 | 356999 | 357109 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
3 | 546367 | 546492 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03977.15 | 1.0 | 3 | 17 | same-strand | Na+-transporting oxaloacetate decarboxylase beta subunit |