Result : EXP02976
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02976 |
| NCBI Accession ID | |
| Organism | Christensenella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGATGCAATTTCAGGTTCCCTCCAGCTTATGTGGCAGGGGATGGTCTCGATCTTTGTGGTAATCGCCGCAATTTGCGTAGCGGTTCTCGTTATTAATAAGGTAACAAGAAGGAAGAAGCAATAG |
| Sequence | MDAISGSLQLMWQGMVSIFVVIAAICVAVLVINKVTRRKKQ |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1002797 | 1002922 | - | NZ_CP029256.1 | Christensenella minuta |
| 2 | 356999 | 357109 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 3 | 546367 | 546492 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029256.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03977.15 | 1.0 | 3 | 17 | same-strand | Na+-transporting oxaloacetate decarboxylase beta subunit |
++ More..