Protein Information |
Information Type | Description |
---|---|
Protein name | Translational regulator CsrA |
NCBI Accession ID | CP001098.1 |
Organism | Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) |
Left | 1827592 |
Right | 1827837 |
Strand | - |
Nucleotide Sequence | ATGCTTATATTAACCCGAAAAAAGGATGAAGCCATTATTATTGATGATAAGATAAAGGTAAAAGTGGTTGAAATAGACGGGAATAAAATTAAACTTGGGATAGAAGCCCCTGATGATGTTACCATTCATAGGGAAGAGGTTTTGAAAGAAATTCTAAAAGAAAATAAACAGGCCTTGAAGCAAAAGAGGGTTCTTAACAGAGATTATACCAGCCGCATTAAAGAGTTTATAGCGAAAAAGGGCTAG |
Sequence | MLILTRKKDEAIIIDDKIKVKVVEIDGNKIKLGIEAPDDVTIHREEVLKEILKENKQALKQKRVLNRDYTSRIKEFIAKKG |
Source of smORF | Swiss-Prot |
Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
Pubmed ID | 19145256 |
Domain | CDD:412510 |
Functional Category | RNA-binding |
Uniprot ID | B8CYT9 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1827592 | 1827837 | - | NC_011899.1 | Halothermothrix orenii H 168 |
2 | 1572340 | 1572564 | - | NZ_CP013661.2 | Planococcus kocurii |
3 | 2634902 | 2635144 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
4 | 1265233 | 1265469 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
5 | 695800 | 696030 | - | NZ_CP063087.1 | Helicobacter winghamensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07195.14 | 0.6 | 3 | 1668 | same-strand | Flagellar hook-associated protein 2 C-terminus |
2 | PF02465.20 | 0.6 | 3 | 1668 | same-strand | Flagellar hook-associated protein 2 N-terminus |
3 | PF03646.17 | 0.6 | 3 | 1389 | same-strand | FlaG protein |
4 | PF00669.22 | 0.6 | 3 | 419.5 | same-strand | Bacterial flagellin N-terminal helical region |
5 | PF02623.17 | 0.8 | 4 | 2.0 | same-strand | FliW protein |