Result : EXP02959
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02959 |
| NCBI Accession ID | |
| Organism | Lactonifactor |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGAAAAAGCGAGAAAATCACAGCTCTGTACGAACGACTGAGCCGTGATGACTTTGGCAAAGATGATGACCAGCAGCGTGAGAGCAATTCCATTTCCAACCATGATGTAATGTATAGAGGGTGGATTACACCAAAAAACATTACATCATGA |
| Sequence | MRKSEKITALYERLSRDDFGKDDDQQRESNSISNHDVMYRGWITPKNITS |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 337851 | 338003 | + | NZ_LR699011.1 | Roseburia hominis |
| 2 | 6470247 | 6470393 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 3 | 2495051 | 2495182 | + | NC_022097.1 | Treponema pedis str. T A4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699011.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14198.8 | 0.67 | 2 | 104.0 | same-strand | Transposon-encoded protein TnpV |
| 2 | PF13310.8 | 0.67 | 2 | 808.5 | opposite-strand | Virulence protein RhuM family |
++ More..