Result : EXP02958
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02958 |
| NCBI Accession ID | |
| Organism | Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAGGTTAGACCATCAGTAAAGAAAATGTGTGACAAATGCAAAGTAATAAAAGAAAAGGTGCAATTAGAGGTATTTGTGAAAACCCTAAACACAAACAAAGACAAGGTTAATTCCTTAAGTTTATAA |
| Sequence | MKVRPSVKKMCDKCKVIKEKVQLEVFVKTLNTNKDKVNSLSL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of CHL00029. Profile Description: ribosomal protein L36 |
| Pubmed ID | 32601270 |
| Domain | CDD:176970 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 332912 | 333031 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 2 | 1091443 | 1091562 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 3 | 799964 | 800083 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 4 | 2256084 | 2256203 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 5 | 1253798 | 1253917 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 6 | 275482 | 275601 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 7 | 523847 | 523966 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 8 | 1765896 | 1766015 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 9 | 2223990 | 2224109 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 10 | 310951 | 311067 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 11 | 3277113 | 3277229 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045563.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.82 | 9 | 2462 | same-strand | ABC transporter |
| 2 | PF02463.21 | 0.82 | 9 | 2462 | same-strand | RecF/RecN/SMC N terminal domain |
| 3 | PF01196.21 | 0.91 | 10 | 1858.0 | same-strand | Ribosomal protein L17 |
| 4 | PF03118.17 | 1.0 | 11 | 883 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
| 5 | PF01000.28 | 0.91 | 10 | 882.0 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
| 6 | PF01193.26 | 0.91 | 10 | 882.0 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |
| 7 | PF00411.21 | 0.91 | 10 | 409.0 | same-strand | Ribosomal protein S11 |
| 8 | PF00416.24 | 0.91 | 10 | 24.0 | same-strand | Ribosomal protein S13/S18 |
| 9 | PF01176.21 | 1.0 | 11 | 28 | same-strand | Translation initiation factor 1A / IF-1 |
| 10 | PF00406.24 | 1.0 | 11 | 409 | same-strand | Adenylate kinase |
| 11 | PF13207.8 | 1.0 | 11 | 409 | same-strand | AAA domain |
| 12 | PF05191.16 | 0.91 | 10 | 396.0 | same-strand | Adenylate kinase, active site lid |
| 13 | PF13238.8 | 0.91 | 10 | 409.5 | same-strand | AAA domain |
| 14 | PF00344.22 | 0.91 | 10 | 1081.0 | same-strand | SecY |
| 15 | PF00828.21 | 0.91 | 10 | 2397.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 16 | PF00327.22 | 0.91 | 10 | 2858.5 | same-strand | Ribosomal protein L30p/L7e |
| 17 | PF13671.8 | 0.64 | 7 | 383 | same-strand | AAA domain |
++ More..