Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02957 |
NCBI Accession ID | |
Organism | Delftia |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAATGACACGACTGTAAAAAGATTTTACGATAATGGCCTTTGGAGCCTTTCTATGGTGCGGGTGGCGGTCCGCAAGGGGATCATTACCAAAACCCAGTTCAAGAAGATCACCGGCAAGACCTTCTAA |
Sequence | MNDTTVKRFYDNGLWSLSMVRVAVRKGIITKTQFKKITGKTF |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
Pubmed ID | 32601270 |
Domain | CDD:420140 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 42 |