Result : EXP02954
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02954 |
| NCBI Accession ID | |
| Organism | Bacteroides,Parabacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGGCAAATACCAGAGTGGCCAAATGGGGCAGACTGTAAATCTGCTGTCTTTCGACTTCGGTGGTTCGAATCCATCTTTGCCCACATTCTTAANANTTGCGGAAGTAGCTCAGTTGATAGAGCATTAG |
| Sequence | MGKYQSGQMGQTVNLLSFDFGGSNPSLPTFLXXAEVAQLIEH |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3693927 | 3694049 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 2 | 3300254 | 3300376 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 3 | 1553910 | 1554044 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 4 | 838212 | 838334 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 5 | 2217453 | 2217563 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 6 | 3541555 | 3541671 | + | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 7 | 2306454 | 2306564 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 8 | 389495 | 389599 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 9 | 397399 | 397503 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 10 | 412419 | 412523 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 11 | 408475 | 408579 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 12 | 420860 | 420964 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 13 | 425945 | 426049 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 14 | 176715 | 176825 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 15 | 2714314 | 2714454 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 16 | 3526184 | 3526303 | - | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 17 | 2875779 | 2875910 | + | NZ_LR134384.1 | Prevotella oris |
| 18 | 2969212 | 2969352 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 19 | 4539764 | 4539901 | - | NZ_CP021434.1 | Tumebacillus avium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP069440.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03946.16 | 0.79 | 15 | 2569 | same-strand | Ribosomal protein L11, N-terminal domain |
| 2 | PF00298.21 | 0.79 | 15 | 2569 | same-strand | Ribosomal protein L11, RNA binding domain |
| 3 | PF02357.21 | 0.79 | 15 | 2011 | same-strand | Transcription termination factor nusG |
| 4 | PF00584.22 | 0.63 | 12 | 1821.0 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
| 5 | PF00009.29 | 0.79 | 15 | 311 | same-strand | Elongation factor Tu GTP binding domain |
| 6 | PF03143.19 | 0.79 | 15 | 311 | same-strand | Elongation factor Tu C-terminal domain |
| 7 | PF03144.27 | 0.79 | 15 | 311 | same-strand | Elongation factor Tu domain 2 |
| 8 | PF01926.25 | 0.79 | 15 | 311 | same-strand | 50S ribosome-binding GTPase |
++ More..