Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02954 |
NCBI Accession ID | |
Organism | Bacteroides,Parabacteroides |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGGCAAATACCAGAGTGGCCAAATGGGGCAGACTGTAAATCTGCTGTCTTTCGACTTCGGTGGTTCGAATCCATCTTTGCCCACATTCTTAANANTTGCGGAAGTAGCTCAGTTGATAGAGCATTAG |
Sequence | MGKYQSGQMGQTVNLLSFDFGGSNPSLPTFLXXAEVAQLIEH |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3693927 | 3694049 | - | NZ_LR699004.1 | Phocaeicola dorei |
2 | 3300254 | 3300376 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
3 | 1553910 | 1554044 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
4 | 838212 | 838334 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
5 | 2217453 | 2217563 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
6 | 3541555 | 3541671 | + | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
7 | 2306454 | 2306564 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
8 | 389495 | 389599 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
9 | 397399 | 397503 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
10 | 412419 | 412523 | + | NC_012039.1 | Campylobacter lari RM2100 |
11 | 408475 | 408579 | + | NZ_CP053825.1 | Campylobacter armoricus |
12 | 420860 | 420964 | + | NZ_CP053848.1 | Campylobacter ornithocola |
13 | 425945 | 426049 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
14 | 176715 | 176825 | + | NZ_AP022847.1 | Nitrosophilus alvini |
15 | 2714314 | 2714454 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
16 | 3526184 | 3526303 | - | NZ_CP035704.1 | Pseudolysobacter antarcticus |
17 | 2875779 | 2875910 | + | NZ_LR134384.1 | Prevotella oris |
18 | 2969212 | 2969352 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
19 | 4539764 | 4539901 | - | NZ_CP021434.1 | Tumebacillus avium |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03946.16 | 0.79 | 15 | 2569 | same-strand | Ribosomal protein L11, N-terminal domain |
2 | PF00298.21 | 0.79 | 15 | 2569 | same-strand | Ribosomal protein L11, RNA binding domain |
3 | PF02357.21 | 0.79 | 15 | 2011 | same-strand | Transcription termination factor nusG |
4 | PF00584.22 | 0.63 | 12 | 1821.0 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
5 | PF00009.29 | 0.79 | 15 | 311 | same-strand | Elongation factor Tu GTP binding domain |
6 | PF03143.19 | 0.79 | 15 | 311 | same-strand | Elongation factor Tu C-terminal domain |
7 | PF03144.27 | 0.79 | 15 | 311 | same-strand | Elongation factor Tu domain 2 |
8 | PF01926.25 | 0.79 | 15 | 311 | same-strand | 50S ribosome-binding GTPase |