Result : B8CXL9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP001098.1 |
| Organism | Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) |
| Left | 1382678 |
| Right | 1382941 |
| Strand | + |
| Nucleotide Sequence | ATGCCAATTATCAAATCTGCAAAAAAGAGGGTAAGAATTACTGAAAAGAGAACTGCTTATAACCGGGAATGGAAAGAAAAAATAAAGCAGGCAATTAAAGAGTTTGAAAAGGTCGTTGAAGAAGGAAATGTTGAAGAGGCAGAAGCCAAACTCCGTGAAGCCAGTAAAATACTAGATAAATCAGCCGGTAAAGGAATTATTCATAAAAATAAAGCGGCCCGTAAAAAGAGCCAGCTTACCAGACAGTTTAATAAAATTGCTTAA |
| Sequence | MPIIKSAKKRVRITEKRTAYNREWKEKIKQAIKEFEKVVEEGNVEEAEAKLREASKILDKSAGKGIIHKNKAARKKSQLTRQFNKIA |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 19145256 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B8CXL9 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1382678 | 1382941 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 2 | 1887014 | 1887274 | + | NC_014654.1 | Halanaerobium hydrogeniformans |
| 3 | 1586759 | 1587031 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 4 | 716907 | 717167 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 5 | 1246787 | 1247053 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 6 | 1930010 | 1930276 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 7 | 3457402 | 3457668 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 8 | 1224761 | 1225051 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 9 | 1973964 | 1974254 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 10 | 1982122 | 1982385 | + | NZ_CP016786.1 | Clostridium isatidis |
| 11 | 1981373 | 1981636 | + | NZ_CP014204.2 | Clostridium baratii |
| 12 | 902348 | 902620 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 13 | 2053248 | 2053535 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 14 | 6751188 | 6751460 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 15 | 2548089 | 2548352 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 16 | 4332809 | 4333075 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 3359032 | 3359298 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 18 | 2726250 | 2726516 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 19 | 3126925 | 3127191 | + | NZ_CP028842.1 | Clostridium botulinum |
| 20 | 1778048 | 1778305 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 21 | 2948989 | 2949252 | + | NZ_CP030775.1 | Clostridium butyricum |
| 22 | 1641457 | 1641717 | + | NZ_HG917868.1 | Clostridium bornimense |
| 23 | 12326 | 12589 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 24 | 2949305 | 2949577 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 25 | 2658258 | 2658521 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 26 | 2683830 | 2684102 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 27 | 348241 | 348459 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 28 | 2010411 | 2010674 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 29 | 1418990 | 1419256 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 30 | 617310 | 617576 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 31 | 76940 | 77203 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 32 | 2149642 | 2149878 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 33 | 747599 | 747868 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 34 | 2586172 | 2586438 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 35 | 3090325 | 3090588 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 36 | 90688 | 90954 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 37 | 2532216 | 2532485 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 38 | 1733055 | 1733324 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 39 | 1404000 | 1404269 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 40 | 3405030 | 3405299 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 41 | 1310360 | 1310626 | - | NZ_CP019870.1 | Clostridioides difficile |
| 42 | 2563711 | 2563974 | + | NZ_CP068345.1 | Succinivibrio dextrinosolvens |
| 43 | 1388144 | 1388407 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 44 | 966673 | 966936 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 45 | 1568403 | 1568690 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 46 | 1293178 | 1293444 | - | NZ_CP040924.1 | Clostridium thermarum |
| 47 | 125651 | 125908 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 48 | 2695119 | 2695421 | - | NZ_CP063458.1 | Humisphaera borealis |
| 49 | 1342425 | 1342691 | + | NC_012803.1 | Micrococcus luteus NCTC 2665 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011899.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 0.63 | 31 | 4893 | opposite-strand | Radical SAM superfamily |
| 2 | PF06969.18 | 0.61 | 30 | 4897.5 | opposite-strand | HemN C-terminal domain |
| 3 | PF00009.29 | 0.82 | 40 | 3017 | opposite-strand | Elongation factor Tu GTP binding domain |
| 4 | PF06421.14 | 0.82 | 40 | 3031.5 | opposite-strand | GTP-binding protein LepA C-terminus |
| 5 | PF00679.26 | 0.8 | 39 | 3013 | opposite-strand | Elongation factor G C-terminus |
| 6 | PF03144.27 | 0.82 | 40 | 3017 | opposite-strand | Elongation factor Tu domain 2 |
| 7 | PF01926.25 | 0.82 | 40 | 3017 | opposite-strand | 50S ribosome-binding GTPase |
| 8 | PF14492.8 | 0.65 | 32 | 3033.5 | opposite-strand | Elongation Factor G, domain III |
| 9 | PF06144.15 | 0.86 | 42 | 87.5 | opposite-strand | DNA polymerase III, delta subunit |
| 10 | PF03772.18 | 0.67 | 33 | 1209 | opposite-strand | Competence protein |
++ More..