Result : B8CWU5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP001098.1 |
| Organism | Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) |
| Left | 1098454 |
| Right | 1098684 |
| Strand | - |
| Nucleotide Sequence | ATGTCCAGGGTTTGTGAAATATGTGGTAAAGGAACTGTTAAAGCCAATAGAATTACCCGCCGTGGTAAAGCAAAAAAAGAAGGCGGTGTTGGGAAACACATTACTAAAACATCCAGACGGAGGCAAAAGCCCAACCTGGTTAAAGTTAAAGCTATTGTAGACGGCAGACCAAAGCGAATAAAAGTATGCACAAAGTGTTTAAAATCAGGGCGGGTTGAAAGAGCATATTAA |
| Sequence | MSRVCEICGKGTVKANRITRRGKAKKEGGVGKHITKTSRRRQKPNLVKVKAIVDGRPKRIKVCTKCLKSGRVERAY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19145256 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B8CWU5 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1098454 | 1098684 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 2 | 1523605 | 1523835 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 3 | 35479 | 35709 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 4 | 1875063 | 1875293 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 5 | 850109 | 850339 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 6 | 2568849 | 2569076 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 7 | 1751950 | 1752180 | + | NC_014654.1 | Halanaerobium hydrogeniformans |
| 8 | 638658 | 638885 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 9 | 2970129 | 2970356 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 10 | 1211848 | 1212078 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 11 | 1208574 | 1208804 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 12 | 503057 | 503287 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 13 | 4806967 | 4807230 | + | NZ_CP042912.1 | Mariniblastus fucicola |
| 14 | 2406914 | 2407105 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 15 | 2157324 | 2157515 | + | NZ_CP009687.1 | Clostridium aceticum |
| 16 | 637290 | 637511 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 17 | 5030611 | 5030874 | - | NZ_LR593887.1 | Tuwongella immobilis |
| 18 | 1955879 | 1956100 | - | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 19 | 2985557 | 2985772 | - | NC_017790.1 | Deinococcus gobiensis I-0 |
| 20 | 2507537 | 2507791 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 21 | 6291812 | 6292072 | + | NZ_CP036273.1 | Urbifossiella limnaea |
| 22 | 112920 | 113183 | + | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
++ More..