Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02942 |
NCBI Accession ID | |
Organism | Bacteroides |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGCTTTTTTTCTTGGATAATTTGCAGATTTATCAAATGTCCGTATATTTGCAACGTGTTTTTCATAGTATTAGATTTAAGGTTAACAAAGGTTGGAGTACAGCGGTACTCCTTTTTTTATGCCAATAA |
Sequence | MLFFLDNLQIYQMSVYLQRVFHSIRFKVNKGWSTAVLLFLCQ |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2564017 | 2564130 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
2 | 5745852 | 5745977 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
3 | 2396152 | 2396268 | + | NZ_CP015401.2 | Bacteroides caecimuris |
4 | 2695507 | 2695632 | - | NZ_CP015401.2 | Bacteroides caecimuris |
5 | 2812612 | 2812743 | - | NZ_LR699004.1 | Phocaeicola dorei |
6 | 2630082 | 2630213 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.6 | 3 | 144 | opposite-strand | ABC transporter |