Result : EXP02942
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02942 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCTTTTTTTCTTGGATAATTTGCAGATTTATCAAATGTCCGTATATTTGCAACGTGTTTTTCATAGTATTAGATTTAAGGTTAACAAAGGTTGGAGTACAGCGGTACTCCTTTTTTTATGCCAATAA |
| Sequence | MLFFLDNLQIYQMSVYLQRVFHSIRFKVNKGWSTAVLLFLCQ |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2564017 | 2564130 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 2 | 5745852 | 5745977 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 3 | 2396152 | 2396268 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 2695507 | 2695632 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 5 | 2812612 | 2812743 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 6 | 2630082 | 2630213 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.6 | 3 | 144 | opposite-strand | ABC transporter |
++ More..