| Protein name |
EXP02939 |
| NCBI Accession ID |
|
| Organism |
Flavonifractor,Clostridium,Oscillibacter |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
ATGCCTCAGATGCTGGGCCAGGCCCTGGTGGGACTGATCCTTATAGGCGTGGTGGCCCTGGCGGTGCGGTCGGTGTGGAAAAGCCGCAAGGCCGGCGGGCACTGCTCGGGAGACTGCAGCCGCTGCGGCGGCGGATGCCATCACGGAAAATGA |
| Sequence |
MPQMLGQALVGLILIGVVALAVRSVWKSRKAGGHCSGDCSRCGGGCHHGK |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of pfam12669. Profile Description: Virus attachment protein p12 family. This family of proteins are related to Virus attachment protein p12 from the African swine fever virus. The family appears to contain an N-terminal signal peptide followed by a short cysteine rich region. The cysteine rich region is extremely variable and it is possible that only the N-terminal region is homologous. |
| Pubmed ID |
32601270
|
| Domain |
CDD:403765 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
50 |