Result : EXP02936
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02936 |
| NCBI Accession ID | |
| Organism | Prevotella,Butyricimonas |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGTAGAAGATGTCCGTCTGGCCGTAGAATGCAAAGTGCCTGTAGAACACTTCGGACGTCTGGGTGGTATTGTTCCCGATCCGGATGAAGTAATCACTGCACTGAAAGAGAAACTAATAAAATAA |
| Sequence | MVEDVRLAVECKVPVEHFGRLGGIVPDPDEVITALKEKLIK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 96
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2987488 | 2987613 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 2 | 3128999 | 3129124 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 3 | 737452 | 737577 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 4 | 150936 | 151061 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 5 | 1193852 | 1193980 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 6 | 243706 | 243831 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 7 | 2658790 | 2658918 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 8 | 1911313 | 1911438 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 9 | 3975095 | 3975220 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 10 | 1573310 | 1573435 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 11 | 1321384 | 1321509 | - | NZ_CP023863.1 | Prevotella jejuni |
| 12 | 1210894 | 1211019 | - | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 13 | 1704248 | 1704373 | + | NZ_CP024727.1 | Prevotella intermedia |
| 14 | 395133 | 395255 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 15 | 2910419 | 2910553 | - | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 16 | 896463 | 896588 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 17 | 900142 | 900267 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 18 | 1160982 | 1161110 | + | NZ_LT608328.1 | Petrimonas mucosa |
| 19 | 3417802 | 3417924 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 20 | 1433332 | 1433460 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 21 | 435441 | 435569 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 22 | 2104650 | 2104772 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 23 | 3398861 | 3398989 | + | NZ_AP018042.1 | Labilibaculum antarcticum |
| 24 | 1967726 | 1967851 | + | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 25 | 1610632 | 1610757 | + | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 26 | 1355641 | 1355763 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 27 | 3045033 | 3045161 | - | NZ_AP019735.1 | Alistipes communis |
| 28 | 2933840 | 2933968 | - | NZ_AP019736.1 | Alistipes dispar |
| 29 | 389699 | 389830 | + | NZ_LR134384.1 | Prevotella oris |
| 30 | 3698766 | 3698894 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 31 | 1029087 | 1029212 | + | NZ_CP013355.1 | Lutibacter profundi |
| 32 | 2165900 | 2166019 | + | NZ_CP013195.1 | Prevotella enoeca |
| 33 | 1703853 | 1703978 | - | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 34 | 1038016 | 1038141 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 35 | 634367 | 634495 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 36 | 364402 | 364527 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 37 | 435776 | 435901 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 38 | 1634015 | 1634143 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 39 | 2067187 | 2067315 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 40 | 394495 | 394623 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 41 | 1425132 | 1425266 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 42 | 1073972 | 1074100 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 43 | 200888 | 201007 | - | NZ_LS974202.1 | Mesotoga infera |
| 44 | 2975677 | 2975811 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 45 | 3808062 | 3808187 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 46 | 705550 | 705681 | + | NZ_CP014176.1 | Clostridium argentinense |
| 47 | 1917769 | 1917897 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 48 | 1080113 | 1080241 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 49 | 1095586 | 1095714 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 50 | 635727 | 635852 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 51 | 940386 | 940508 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 52 | 624823 | 624948 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 53 | 114841 | 114966 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 54 | 649103 | 649231 | - | NZ_CP015402.2 | Muribaculum intestinale |
| 55 | 200711 | 200830 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 56 | 154086 | 154205 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 57 | 1590173 | 1590292 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 58 | 2291687 | 2291818 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 59 | 2494531 | 2494659 | + | NZ_LR027382.1 | Alistipes megaguti |
| 60 | 2660231 | 2660365 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 61 | 106180 | 106305 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 62 | 1460919 | 1461062 | + | NZ_CP036259.1 | Sporomusa termitida |
| 63 | 1491207 | 1491338 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 64 | 1944613 | 1944744 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 65 | 2010591 | 2010722 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 66 | 1457724 | 1457846 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 67 | 273632 | 273760 | + | NZ_CP029256.1 | Christensenella minuta |
| 68 | 3116316 | 3116447 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 69 | 1711357 | 1711491 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 70 | 640098 | 640223 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 71 | 2159003 | 2159134 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 72 | 27394 | 27525 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 73 | 2508071 | 2508199 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 74 | 1875958 | 1876092 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 75 | 847574 | 847702 | + | NZ_LR698974.1 | Candidatus Methanomassiliicoccus intestinalis |
| 76 | 1387650 | 1387778 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 77 | 984582 | 984710 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 78 | 4388901 | 4389032 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 79 | 1755408 | 1755539 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 80 | 2721718 | 2721849 | - | NZ_CP020953.1 | Clostridium drakei |
| 81 | 5237933 | 5238064 | - | NZ_CP020953.1 | Clostridium drakei |
| 82 | 1882202 | 1882333 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 83 | 1718182 | 1718304 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 84 | 2943417 | 2943542 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 85 | 4684321 | 4684452 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 86 | 1477050 | 1477181 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 87 | 1602709 | 1602834 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 88 | 1420735 | 1420869 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 89 | 829987 | 830115 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 90 | 271443 | 271577 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 91 | 1832105 | 1832233 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 92 | 1864175 | 1864309 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 93 | 1867245 | 1867373 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 94 | 1964672 | 1964803 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 95 | 1899187 | 1899318 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 96 | 3733181 | 3733312 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 97 | 755414 | 755536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 98 | 2622118 | 2622252 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 99 | 1618971 | 1619093 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP069440.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01558.20 | 1.0 | 96 | 777.0 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 2 | PF02775.23 | 0.98 | 94 | 5 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 3 | PF00037.29 | 0.96 | 92 | 964 | same-strand | 4Fe-4S binding domain |
| 4 | PF12797.9 | 0.95 | 91 | 966 | same-strand | 4Fe-4S binding domain |
| 5 | PF12838.9 | 0.99 | 95 | 964 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF13237.8 | 0.95 | 91 | 966 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13187.8 | 0.97 | 93 | 964 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12837.9 | 0.81 | 78 | 964 | same-strand | 4Fe-4S binding domain |
++ More..