Result : EXP02925

Protein Information

• Protein name: EXP02925
• Nucleotide Sequence: ATGATCTGGGAAGGTCAGTCGAAGAAGGTAATAACCCTGTATGCGAAAGCCAGAAATTTGGGGAAGGATCCGGAGTACCACGAAGCACGTGAAATTTCGTGGGAAGCAGGGGGGACCACCCTCCAAGGCTAA
• Sequence: MIWEGQSKKVITLYAKARNLGKDPEYHEAREISWEAGGTTLQG
• Source of smORF: Metagenomic Ribo-seq
• Pubmed ID: 32601270
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 43

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2020973	2021080	-	NC_007503.1	Carboxydothermus hydrogenoformans Z-2901
2	1896488	1896595	-	NC_007503.1	Carboxydothermus hydrogenoformans Z-2901
3	1395461	1395568	-	NC_007503.1	Carboxydothermus hydrogenoformans Z-2901
4	2111392	2111499	-	NC_007503.1	Carboxydothermus hydrogenoformans Z-2901
5	3874878	3875006	-	NZ_CP009687.1	Clostridium aceticum
6	3727429	3727557	-	NZ_CP009687.1	Clostridium aceticum
7	1163789	1163917	+	NZ_CP009687.1	Clostridium aceticum
8	41490	41618	+	NZ_CP020559.1	Clostridium formicaceticum
9	4242289	4242417	-	NZ_CP020559.1	Clostridium formicaceticum
10	4111840	4111968	-	NZ_CP020559.1	Clostridium formicaceticum
11	4084644	4084772	-	NZ_CP020559.1	Clostridium formicaceticum
12	1392705	1392833	+	NZ_CP020559.1	Clostridium formicaceticum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP020559.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07724.16	0.67	2	4662.5	same-strand	AAA domain (Cdc48 subfamily)
2	PF00004.31	0.67	2	5288	same-strand	ATPase family associated with various cellular activities (AAA)
3	PF07728.16	0.67	2	4662.5	same-strand	AAA domain (dynein-related subfamily)
4	PF17975.3	0.67	2	3937.5	same-strand	Ribonucleotide reductase alpha domain
5	PF03477.18	0.67	2	3937.5	same-strand	ATP cone domain
6	PF14595.8	0.67	2	3138.5	same-strand	Thioredoxin
7	PF00152.22	0.67	2	2572.5	same-strand	tRNA synthetases class II (D, K and N)
8	PF01336.27	0.67	2	2572.5	same-strand	OB-fold nucleic acid binding domain
9	PF03449.17	0.67	2	4123.0	same-strand	Transcription elongation factor, N-terminal
10	PF01272.21	0.67	2	4123.0	same-strand	Transcription elongation factor, GreA/GreB, C-term
11	PF04972.19	0.67	2	7600.0	opposite-strand	BON domain
12	PF00764.21	0.67	2	6225.0	opposite-strand	Arginosuccinate synthase
13	PF01488.22	0.67	2	5107.0	same-strand	Shikimate / quinate 5-dehydrogenase
14	PF00202.23	0.67	2	3690.5	same-strand	Aminotransferase class-III
15	PF07613.13	0.67	2	3081.0	same-strand	Protein of unknown function (DUF1576)
16	PF00885.21	0.67	2	4798.0	same-strand	6,7-dimethyl-8-ribityllumazine synthase