Result : B7NDD9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0213 protein YhbQ |
| NCBI Accession ID | CU928163.2 |
| Organism | Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) |
| Left | 3751833 |
| Right | 3752135 |
| Strand | + |
| Nucleotide Sequence | ATGACACCCTGGTTTCTTTACTTGATCCGTACCGCCGACAATAAGCTTTATACCGGGATCACCACGGATGTCGAACGCCGCTATCAGCAGCACCAAAGCGGCAAAGGGGCGAAAGCACTGCGCGGGAAAGGAGAACTAACGCTGGCGTTTTCCGCGCCAGTGGGCGATCGTTCGCTGGCGTTACGGGCAGAATATCGCGTTAAGCAACTGACCAAACGGCAAAAAGAACGTCTGGTAGCGGAAGGCGCAGGGTTTGCAGAACTGTTGAGCAGCCTGCAAACCCCAAAGGTTAAAAGCGATTGA |
| Sequence | MTPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLAFSAPVGDRSLALRAEYRVKQLTKRQKERLVAEGAGFAELLSSLQTPKVKSD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
| Pubmed ID | 19165319 |
| Domain | CDD:417687 |
| Functional Category | Others |
| Uniprot ID | B7NDD9 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 125
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3292172 | 3292474 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 517138 | 517440 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 3299966 | 3300268 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4042592 | 4042894 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3806150 | 3806452 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2212973 | 2213275 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 3285178 | 3285480 | + | NZ_AP014857.1 | Escherichia albertii |
| 8 | 5314225 | 5314527 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 1803819 | 1804121 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 4205008 | 4205310 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 2103792 | 2104091 | + | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 3438753 | 3439055 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 13 | 2977498 | 2977788 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 4936146 | 4936439 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 15 | 1295747 | 1296049 | + | NZ_CP053416.1 | Salmonella bongori |
| 16 | 3975332 | 3975631 | - | NZ_CP038469.1 | Citrobacter tructae |
| 17 | 5284503 | 5284805 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 18 | 2839775 | 2840074 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 19 | 2559192 | 2559494 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 20 | 3687927 | 3688229 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 21 | 603053 | 603352 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 22 | 4306538 | 4306840 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 23 | 1121830 | 1122123 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 24 | 4243465 | 4243752 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 25 | 581838 | 582170 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 26 | 4742062 | 4742364 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 27 | 533100 | 533408 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 28 | 4264503 | 4264790 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 29 | 4136211 | 4136498 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 30 | 3167663 | 3167950 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 31 | 4104513 | 4104800 | + | NC_015968.1 | Enterobacter soli |
| 32 | 541046 | 541348 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 33 | 648374 | 648658 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 34 | 2943124 | 2943411 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 35 | 3667561 | 3667848 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 36 | 483869 | 484156 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 37 | 500756 | 501043 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 38 | 592886 | 593128 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 39 | 4048561 | 4048848 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 40 | 4213965 | 4214252 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 41 | 497678 | 497965 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 42 | 1872521 | 1872808 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 43 | 4037557 | 4037841 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 44 | 369495 | 369797 | - | NZ_LR134201.1 | Cedecea lapagei |
| 45 | 3541127 | 3541414 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 46 | 1123232 | 1123498 | + | NZ_CP026047.1 | Raoultella planticola |
| 47 | 4477553 | 4477840 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 48 | 547164 | 547448 | - | NZ_CP041247.1 | Raoultella electrica |
| 49 | 599787 | 600071 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 50 | 556966 | 557250 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 51 | 4123598 | 4123885 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 52 | 698205 | 698489 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 53 | 1107288 | 1107590 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 54 | 366258 | 366551 | - | NZ_CP023525.1 | Cedecea neteri |
| 55 | 567607 | 567891 | - | NZ_CP050508.1 | Raoultella terrigena |
| 56 | 4718966 | 4719250 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 57 | 574490 | 574774 | - | NZ_CP054254.1 | Klebsiella variicola |
| 58 | 293439 | 293705 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 59 | 535677 | 535943 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 60 | 571958 | 572242 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 61 | 1796335 | 1796622 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 62 | 447435 | 447737 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 63 | 589739 | 590038 | - | NZ_CP050150.1 | Hafnia alvei |
| 64 | 4589391 | 4589639 | + | NZ_CP071320.1 | Serratia ureilytica |
| 65 | 4915893 | 4916141 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 66 | 2555296 | 2555568 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 67 | 400915 | 401259 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 68 | 2675575 | 2675886 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 69 | 1982770 | 1983012 | - | NZ_CP065640.1 | Serratia rubidaea |
| 70 | 4555641 | 4555940 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 71 | 717903 | 718202 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 72 | 895666 | 895965 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 73 | 4088161 | 4088460 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 74 | 3157009 | 3157326 | + | NZ_LS483470.1 | Leminorella richardii |
| 75 | 1998279 | 1998527 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 76 | 2399701 | 2399949 | - | NZ_CP011254.1 | Serratia fonticola |
| 77 | 3274889 | 3275161 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 78 | 675769 | 676080 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 79 | 768437 | 768688 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 80 | 598269 | 598562 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 81 | 4664847 | 4665110 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 82 | 219009 | 219269 | + | NZ_CP035689.1 | Vibrio metoecus |
| 83 | 604963 | 605232 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 84 | 1298432 | 1298713 | - | NZ_AP014636.1 | Vibrio tritonius |
| 85 | 5259942 | 5260208 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 86 | 2434326 | 2434592 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 87 | 3097540 | 3097818 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 88 | 4881045 | 4881344 | + | NZ_CP028897.1 | Dongshaea marina |
| 89 | 3383549 | 3383806 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 90 | 467988 | 468281 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 91 | 1860908 | 1861174 | + | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 92 | 1696522 | 1696764 | + | NZ_CP009468.1 | Vibrio harveyi |
| 93 | 660897 | 661181 | + | NC_011313.1 | Aliivibrio salmonicida LFI1238 |
| 94 | 3775674 | 3775955 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 95 | 1416752 | 1417021 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 96 | 1769462 | 1769743 | - | NZ_CP025793.1 | Vibrio jasicida 090810c |
| 97 | 535067 | 535384 | + | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 98 | 1792236 | 1792529 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 99 | 639501 | 639785 | - | NC_013457.1 | Vibrio antiquarius |
| 100 | 418152 | 418430 | + | NZ_CP022742.1 | Vibrio qinghaiensis |
| 101 | 15097 | 15414 | + | NZ_CP033077.1 | Vibrio zhugei |
| 102 | 1145642 | 1145917 | - | NZ_CP005973.1 | Photobacterium gaetbulicola Gung47 |
| 103 | 3195696 | 3195974 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 104 | 1002344 | 1002592 | - | NZ_CP009355.1 | Vibrio tubiashii ATCC 19109 |
| 105 | 492679 | 492972 | - | NZ_CP016415.1 | Vibrio scophthalmi |
| 106 | 686540 | 686854 | + | NZ_CP009978.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 107 | 304358 | 304636 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 108 | 394477 | 394752 | - | NZ_CP040449.1 | Aeromonas simiae |
| 109 | 3449229 | 3449510 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 110 | 1311661 | 1311906 | + | NZ_CP030789.1 | Vibrio campbellii |
| 111 | 415021 | 415344 | + | NZ_CP014055.2 | Grimontia hollisae |
| 112 | 2621281 | 2621556 | + | NZ_CP044060.1 | Aeromonas veronii |
| 113 | 1222226 | 1222489 | + | NZ_CP070625.1 | Photobacterium damselae subsp. damselae |
| 114 | 555108 | 555350 | + | NZ_CP019960.1 | Vibrio owensii |
| 115 | 1253966 | 1254223 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 116 | 939888 | 940157 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 117 | 1972029 | 1972340 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 118 | 4322667 | 4322918 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 119 | 3365099 | 3365368 | + | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 120 | 1409339 | 1409644 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 121 | 151182 | 151430 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 122 | 817148 | 817417 | - | NZ_CP070273.1 | Marinomonas foliarum |
| 123 | 1973959 | 1974234 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 124 | 239980 | 240255 | + | NZ_CP046378.1 | Shewanella algae |
| 125 | 2339205 | 2339507 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 126 | 3365734 | 3366072 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13508.9 | 0.7 | 88 | -13 | opposite-strand | Acetyltransferase (GNAT) domain |
| 2 | PF13527.9 | 0.6 | 75 | -13.0 | opposite-strand | Acetyltransferase (GNAT) domain |
| 3 | PF02036.19 | 0.66 | 83 | 484.0 | opposite-strand | SCP-2 sterol transfer family |
| 4 | PF01136.21 | 0.66 | 82 | 1230 | same-strand | Peptidase family U32 |
++ More..