Result : EXP02922
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02922 |
| NCBI Accession ID | |
| Organism | Faecalibacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAACGTATTAAGACCATTGCTACTCGTGACCTGACCAAGAGTGTTAAGACCGGCGGCTGCGGCGAGTGCCAGACTTCCTGCCAGTCCGCTTGCAAGACCTCCCGCGCCCTGGCCAGTAAGTACCGGTAG |
| Sequence | MERIKTIATRDLTKSVKTGGCGECQTSCQSACKTSRALASKYR |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 72
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1172356 | 1172502 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 2 | 3056890 | 3057036 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 3 | 1942960 | 1943106 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 4 | 1395279 | 1395422 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 5 | 862426 | 862575 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 6 | 601944 | 602084 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 7 | 1444833 | 1444985 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 8 | 1208026 | 1208175 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 9 | 1822854 | 1823003 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 10 | 982574 | 982720 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 11 | 3266827 | 3266973 | - | NZ_CP048649.1 | Aminipila butyrica |
| 12 | 3922457 | 3922606 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 13 | 356721 | 356864 | + | NZ_CP029256.1 | Christensenella minuta |
| 14 | 2635490 | 2635630 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 15 | 2442828 | 2442968 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 16 | 332133 | 332282 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 17 | 1940752 | 1940892 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 18 | 4104008 | 4104157 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 19 | 1794164 | 1794304 | + | NZ_CP009687.1 | Clostridium aceticum |
| 20 | 619980 | 620120 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 21 | 2083054 | 2083194 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 22 | 1821073 | 1821213 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 23 | 784566 | 784715 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 24 | 4570159 | 4570308 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 25 | 2411970 | 2412110 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 26 | 2265150 | 2265290 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 27 | 2284239 | 2284376 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 28 | 1561107 | 1561247 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 29 | 5670873 | 5671013 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 30 | 1550695 | 1550835 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 31 | 2148048 | 2148197 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 32 | 954144 | 954293 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 33 | 2263118 | 2263261 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 34 | 1212127 | 1212270 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 35 | 2478577 | 2478723 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 36 | 3118378 | 3118521 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 37 | 687921 | 688064 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 38 | 889916 | 890059 | + | NZ_CP019870.1 | Clostridioides difficile |
| 39 | 1074330 | 1074467 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 40 | 1711762 | 1711902 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 41 | 1558427 | 1558564 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 42 | 1482480 | 1482617 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 43 | 1560096 | 1560233 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 44 | 1094182 | 1094319 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 45 | 1188462 | 1188599 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 46 | 1065811 | 1065948 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 47 | 3133583 | 3133720 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 48 | 1098241 | 1098378 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 49 | 2211193 | 2211330 | - | NZ_HG917868.1 | Clostridium bornimense |
| 50 | 2140498 | 2140635 | - | NZ_CP014204.2 | Clostridium baratii |
| 51 | 2482060 | 2482197 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 52 | 1364346 | 1364483 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 53 | 3691158 | 3691295 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 54 | 1740452 | 1740589 | + | NZ_CP014176.1 | Clostridium argentinense |
| 55 | 927998 | 928135 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 56 | 1931380 | 1931517 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 57 | 2385736 | 2385876 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 58 | 2393556 | 2393693 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 59 | 966519 | 966656 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 60 | 2592232 | 2592369 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 61 | 3221953 | 3222090 | - | NZ_CP028842.1 | Clostridium botulinum |
| 62 | 3452301 | 3452438 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 63 | 585306 | 585443 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 64 | 1665250 | 1665387 | + | NZ_CP040924.1 | Clostridium thermarum |
| 65 | 2807169 | 2807306 | - | NZ_CP030775.1 | Clostridium butyricum |
| 66 | 1373262 | 1373399 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 67 | 4290797 | 4290934 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 68 | 1805936 | 1806073 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 69 | 2587984 | 2588121 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 70 | 2440709 | 2440849 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 71 | 4717886 | 4718023 | - | NZ_CP043998.1 | Clostridium diolis |
| 72 | 905045 | 905188 | - | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP066014.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 0.78 | 56 | 102 | same-strand | Radical SAM superfamily |
| 2 | PF13353.8 | 0.69 | 50 | 101.5 | same-strand | 4Fe-4S single cluster domain |
| 3 | PF13186.8 | 0.83 | 60 | 86.0 | same-strand | Iron-sulfur cluster-binding domain |
| 4 | PF13394.8 | 0.61 | 44 | 78.0 | same-strand | 4Fe-4S single cluster domain |
++ More..