Result : EXP02921
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02921 |
| NCBI Accession ID | |
| Organism | Bifidobacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAACGAGAACATCGACATCGACATCGACACCACTTTCGTGCCGGACGATTCCGCCAGCCATTCCTGGACGGAGCGCGACAGCGAGCTTGTGGAGGAGTATGCGGCCCAGCTCATGGCGATGAGCATCTGA |
| Sequence | MNENIDIDIDTTFVPDDSASHSWTERDSELVEEYAAQLMAMSI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1194997 | 1195122 | - | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 2 | 1091777 | 1091902 | + | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 3 | 1150198 | 1150317 | + | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 4 | 1268824 | 1268940 | + | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP012325.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13555.8 | 0.75 | 3 | 3029 | same-strand | P-loop containing region of AAA domain |
| 2 | PF13558.8 | 1.0 | 4 | 3029.0 | same-strand | Putative exonuclease SbcCD, C subunit |
| 3 | PF13835.8 | 1.0 | 4 | 1983.5 | same-strand | Domain of unknown function (DUF4194) |
| 4 | PF11855.10 | 1.0 | 4 | 474.0 | same-strand | Protein of unknown function (DUF3375) |
| 5 | PF07883.13 | 0.75 | 3 | 209 | opposite-strand | Cupin domain |
| 6 | PF04892.14 | 0.75 | 3 | 863 | same-strand | VanZ like family |
| 7 | PF06271.14 | 0.75 | 3 | 863 | same-strand | RDD family |
| 8 | PF00005.29 | 0.75 | 3 | 3410 | same-strand | ABC transporter |
++ More..