Result : EXP02920
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02920 |
| NCBI Accession ID | |
| Organism | Barnesiella,Bacteroides,Prevotella,Paraprevotella,Alistipes,Tannerella,Parabacteroides,Odoribacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATGAAAGAACAAATGACAGTAGAGATGCTTCGGTATCAGATAGCGAAGTATCGAGTAATGGGAAATGGCGCCATGTGCCAAGAGTTAACAGCCTTATTACAAAAAAAATTGGCAGCTGCGGTTGCCTGA |
| Sequence | MMKEQMTVEMLRYQIAKYRVMGNGAMCQELTALLQKKLAAAVA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1257516 | 1257647 | - | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 2 | 289258 | 289398 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 3 | 1966237 | 1966377 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 4 | 3115222 | 3115329 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 5 | 3236549 | 3236677 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027234.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01841.21 | 0.6 | 3 | 3780 | opposite-strand | Transglutaminase-like superfamily |
++ More..