Result : B7N114
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein AaeX |
| NCBI Accession ID | CU928162.2 |
| Organism | Escherichia coli O81 (strain ED1a) |
| Left | 3821666 |
| Right | 3821869 |
| Strand | - |
| Nucleotide Sequence | ATGAGTCTGTTTCCCGTTATCGTGGTGTTTGGGCTGTCCTTCCCACCGATATTTTTCGAATTGCTTTTATCACTGGCGATTTTCTGGCTGGTGCGCCGGGTACTTGTGCCAACAGGTATTTACGACTTTGTCTGGCATCCGGCGTTGTTCAACACCGCGCTCTATTGCTGCTTGTTTTATTTGATATCGCGACTGTTCGTTTGA |
| Sequence | MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFYLISRLFV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26842. Profile Description: Protein of unknown function (DUF1656). efflux system membrane protein; Provisional |
| Pubmed ID | 19165319 |
| Domain | CDD:421401 |
| Functional Category | Others |
| Uniprot ID | B7N114 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 123
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3389134 | 3389337 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3363349 | 3363552 | - | NZ_AP014857.1 | Escherichia albertii |
| 3 | 434835 | 435038 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3376985 | 3377188 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3891713 | 3891916 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1720499 | 1720702 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 3070559 | 3070762 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 8 | 4823392 | 4823595 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 5404854 | 5405057 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 4334818 | 4335021 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 11 | 3891527 | 3891730 | + | NZ_CP038469.1 | Citrobacter tructae |
| 12 | 2189321 | 2189524 | - | NZ_CP033744.1 | Citrobacter freundii |
| 13 | 4285591 | 4285794 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 14 | 3532920 | 3533123 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 15 | 1382809 | 1383012 | - | NZ_CP053416.1 | Salmonella bongori |
| 16 | 1964007 | 1964210 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 17 | 4136167 | 4136370 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 18 | 4210143 | 4210346 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 19 | 4229077 | 4229280 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 20 | 4226573 | 4226776 | - | NC_015968.1 | Enterobacter soli |
| 21 | 4173142 | 4173345 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 22 | 4116773 | 4116976 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 23 | 4565181 | 4565384 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 4814641 | 4814844 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 25 | 518946 | 519149 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 26 | 509421 | 509624 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 27 | 4387290 | 4387493 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 28 | 2893327 | 2893530 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 29 | 4124496 | 4124699 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 30 | 418200 | 418403 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 31 | 3615270 | 3615473 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 32 | 464399 | 464602 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 33 | 1036618 | 1036821 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 34 | 5198790 | 5198993 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 35 | 2178767 | 2178970 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 36 | 373012 | 373215 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 37 | 3023977 | 3024180 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 38 | 3743433 | 3743636 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 39 | 408052 | 408255 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 40 | 423248 | 423451 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 41 | 3620696 | 3620899 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 42 | 455147 | 455350 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 43 | 2637215 | 2637418 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 44 | 2309799 | 2310002 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 45 | 601361 | 601564 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 46 | 483151 | 483354 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 47 | 478415 | 478618 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 48 | 4796628 | 4796831 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 49 | 488167 | 488370 | + | NZ_CP054254.1 | Klebsiella variicola |
| 50 | 563429 | 563632 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 51 | 512030 | 512233 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 52 | 2931335 | 2931538 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 53 | 475381 | 475584 | + | NZ_CP041247.1 | Raoultella electrica |
| 54 | 1202952 | 1203155 | - | NZ_CP026047.1 | Raoultella planticola |
| 55 | 513619 | 513822 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 56 | 457159 | 457362 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 57 | 481757 | 481960 | + | NZ_CP050508.1 | Raoultella terrigena |
| 58 | 290215 | 290418 | + | NZ_CP023525.1 | Cedecea neteri |
| 59 | 296049 | 296252 | + | NZ_LR134201.1 | Cedecea lapagei |
| 60 | 363307 | 363510 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 61 | 4533004 | 4533207 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 62 | 535263 | 535466 | + | NZ_CP026377.1 | Mixta gaviniae |
| 63 | 460751 | 460954 | + | NZ_CP061511.1 | Mixta calida |
| 64 | 326095 | 326298 | + | NZ_CP046293.1 | Yersinia intermedia |
| 65 | 4284306 | 4284509 | + | NZ_CP028271.1 | Mixta intestinalis |
| 66 | 480052 | 480255 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 67 | 1138035 | 1138238 | - | NZ_CP011254.1 | Serratia fonticola |
| 68 | 3639584 | 3639787 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 69 | 1130306 | 1130509 | - | NZ_CP019706.1 | Pantoea alhagi |
| 70 | 975648 | 975851 | - | NZ_CP065640.1 | Serratia rubidaea |
| 71 | 478152 | 478355 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 72 | 2384012 | 2384215 | - | NZ_CP049115.1 | Pantoea stewartii |
| 73 | 347554 | 347757 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 74 | 512263 | 512466 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 75 | 490168 | 490371 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 76 | 1790117 | 1790320 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 77 | 3557528 | 3557731 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 78 | 347646 | 347849 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 79 | 4116407 | 4116610 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 80 | 513662 | 513865 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 81 | 523742 | 523945 | + | NZ_CP038853.1 | Pantoea vagans |
| 82 | 659038 | 659241 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 83 | 3222807 | 3223010 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 84 | 2234778 | 2234981 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 85 | 1071979 | 1072182 | - | NZ_CP007230.1 | Yersinia similis |
| 86 | 2473510 | 2473713 | - | NZ_CP009787.1 | Yersinia rohdei |
| 87 | 4851734 | 4851937 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 88 | 4646815 | 4647018 | - | NZ_LT906479.1 | Serratia ficaria |
| 89 | 3142784 | 3142987 | - | NZ_CP067057.1 | Rahnella aceris |
| 90 | 3750013 | 3750216 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 91 | 504399 | 504602 | + | NZ_CP071320.1 | Serratia ureilytica |
| 92 | 3901766 | 3901969 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 93 | 4685419 | 4685622 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 94 | 4739522 | 4739725 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 95 | 209574 | 209777 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 96 | 556871 | 557074 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 97 | 343734 | 343937 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 98 | 4608525 | 4608728 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 99 | 4513170 | 4513373 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 100 | 332131 | 332334 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 101 | 4098033 | 4098236 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 102 | 2099546 | 2099749 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 103 | 1275325 | 1275528 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 104 | 4260389 | 4260592 | - | NZ_CP032487.1 | Yersinia hibernica |
| 105 | 329648 | 329851 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 106 | 1285288 | 1285491 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 107 | 3550563 | 3550766 | - | NZ_CP065534.1 | Lonsdalea populi |
| 108 | 3377081 | 3377284 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 109 | 713685 | 713888 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 110 | 1392850 | 1393053 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 111 | 170915 | 171118 | + | NZ_CP015581.1 | Tatumella citrea |
| 112 | 4134908 | 4135111 | - | NZ_CP050150.1 | Hafnia alvei |
| 113 | 4198769 | 4198972 | - | NZ_CP043727.1 | Yersinia canariae |
| 114 | 4069507 | 4069710 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 115 | 322170 | 322373 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 116 | 333461 | 333664 | + | NZ_CP025799.1 | Dickeya zeae |
| 117 | 331263 | 331466 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 118 | 2448996 | 2449199 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 119 | 2490380 | 2490583 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 120 | 4324016 | 4324219 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 121 | 374746 | 374949 | + | NZ_LT615367.1 | Dickeya aquatica |
| 122 | 4252045 | 4252248 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 123 | 4790503 | 4790706 | - | NZ_LR134494.1 | Serratia quinivorans |
| 124 | 2119973 | 2120176 | + | NZ_CP023706.1 | Edwardsiella tarda |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04632.14 | 1.0 | 123 | 946.0 | same-strand | Fusaric acid resistance protein family |
| 2 | PF13515.8 | 1.0 | 123 | 946.0 | same-strand | Fusaric acid resistance protein-like |
| 3 | PF13533.8 | 1.0 | 123 | 8.0 | same-strand | Biotin-lipoyl like |
| 4 | PF16576.7 | 1.0 | 123 | 8 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 5 | PF13437.8 | 0.93 | 114 | 8.0 | same-strand | HlyD family secretion protein |
| 6 | PF00529.22 | 0.99 | 122 | 8 | same-strand | Cation efflux system protein CusB domain 1 |
| 7 | PF03466.22 | 0.99 | 122 | 230 | opposite-strand | LysR substrate binding domain |
| 8 | PF00126.29 | 0.99 | 122 | 231 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 9 | PF19289.1 | 0.9 | 111 | 1284 | same-strand | PmbA/TldA metallopeptidase C-terminal domain |
| 10 | PF19290.1 | 0.9 | 111 | 1284 | same-strand | PmbA/TldA metallopeptidase central domain |
| 11 | PF13116.8 | 0.86 | 106 | 2816 | same-strand | Protein of unknown function |
| 12 | PF13502.8 | 0.86 | 106 | 2816 | same-strand | AsmA-like C-terminal region |
| 13 | PF10150.11 | 0.82 | 101 | 6713.5 | same-strand | Ribonuclease E/G family |
| 14 | PF02545.16 | 0.63 | 77 | 8125.5 | same-strand | Maf-like protein |
++ More..