Result : B7KX02
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP001298.1 |
| Organism | Methylorubrum extorquens (strain CM4 / NCIMB 13688) (Methylobacterium extorquens) |
| Left | 3912041 |
| Right | 3912328 |
| Strand | + |
| Nucleotide Sequence | ATGGGCAGCATGAGTGTCTGGCACTGGGTCATCGTGGCGGTCGTCGTCATGCTGCTGTTCGGCCGCGGCAAGGTGTCGGAGCTGATGGGCGACGTCGCCAAGGGCATCAAGGCCTTCAAGAAGGGCATGGCCGACGACGAGACCCAGCCGAATACGGCGACGAGCGTGCCCCCGGTGGGCCCGAACGATCCGGTCCGCACGCTGCCGCACCAGGGCGCGCCGGGCACCGCCCCGCAGCCGCCGCATGTTCAGCCGCACGTGTCGGCGGGCGACCATAAGGCCGTCTGA |
| Sequence | MGSMSVWHWVIVAVVVMLLFGRGKVSELMGDVAKGIKAFKKGMADDETQPNTATSVPPVGPNDPVRTLPHQGAPGTAPQPPHVQPHVSAGDHKAV |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | B7KX02 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3540620 | 3540895 | + | NZ_CP039546.1 | Methylorubrum populi |
| 2 | 6257269 | 6257562 | - | NZ_CP029550.1 | Methylobacterium durans |
| 3 | 2885279 | 2885551 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 4 | 2357901 | 2358173 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 5 | 3147328 | 3147600 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 6 | 2294930 | 2295202 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 7 | 2900916 | 2901188 | - | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 8 | 1846362 | 1846601 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 9 | 5587351 | 5587587 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 10 | 3432405 | 3432638 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 11 | 4231299 | 4231532 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 12 | 3539645 | 3539878 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 13 | 3507606 | 3507839 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 14 | 5700543 | 5700776 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 15 | 3501145 | 3501378 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 16 | 3974827 | 3975060 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 17 | 6322942 | 6323175 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 18 | 5196799 | 5197032 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 19 | 5011706 | 5011942 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 20 | 4817426 | 4817662 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 21 | 1989876 | 1990115 | + | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 22 | 6628198 | 6628431 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 23 | 2958323 | 2958574 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 24 | 307243 | 307491 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 25 | 2456291 | 2456533 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030050.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05746.17 | 0.84 | 21 | 4537 | same-strand | DALR anticodon binding domain |
| 2 | PF03485.18 | 0.84 | 21 | 4537 | same-strand | Arginyl tRNA synthetase N terminal domain |
| 3 | PF05036.15 | 0.96 | 24 | 2850.5 | same-strand | SPOR domain |
| 4 | PF00933.23 | 0.84 | 21 | 1776 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 5 | PF00902.20 | 0.96 | 24 | 615.0 | same-strand | Sec-independent protein translocase protein (TatC) |
| 6 | PF00587.27 | 0.68 | 17 | 1614 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 7 | PF02403.24 | 0.68 | 17 | 1614 | same-strand | Seryl-tRNA synthetase N-terminal domain |
| 8 | PF04079.18 | 0.68 | 17 | 167 | same-strand | Segregation and condensation complex subunit ScpB |
| 9 | PF01975.19 | 0.6 | 15 | 3480 | same-strand | Survival protein SurE |
++ More..