Result : B7KKZ9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001291.1 |
| Organism | Gloeothece citriformis (strain PCC 7424) (Cyanothece sp. (strain PCC 7424)) |
| Left | 4429739 |
| Right | 4430035 |
| Strand | + |
| Nucleotide Sequence | ATGATTGATACAGAACAAGTTAAGAAAATTGCTCATCTTGCGCGTTTGGAAATTACCCCCGAACAAGAGGAACAATTTACCGGACAACTGAGCAGTATTTTAGAATATTTTGACCAATTAAGTGAATTAGACACCACTGATGTTCCTCCCACTACCAGGGCTATTGAAATCAAGAATATTACTCGTTCTGATTCCATGCAACCCTATCCCAGTCGAGAAGAACTCCTTAAAGAAGCACCCGAACAAGAAGGGGACTTTTTTAAAGTTCCTCAAATTCTGAATACCGATGAGGAATAA |
| Sequence | MIDTEQVKKIAHLARLEITPEQEEQFTGQLSSILEYFDQLSELDTTDVPPTTRAIEIKNITRSDSMQPYPSREELLKEAPEQEGDFFKVPQILNTDEE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 21972240 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B7KKZ9 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4429739 | 4430035 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 2 | 5238055 | 5238351 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 760639 | 760935 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 4 | 3669843 | 3670133 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 5 | 4004481 | 4004771 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 6 | 4432522 | 4432815 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 7 | 749097 | 749393 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 8 | 3072071 | 3072361 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 9 | 7675287 | 7675577 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 10 | 3176511 | 3176804 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 11 | 4732470 | 4732760 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 12 | 4280100 | 4280390 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 13 | 4026578 | 4026868 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 14 | 6157013 | 6157303 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 15 | 2521879 | 2522169 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 16 | 4433803 | 4434093 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 17 | 2062250 | 2062540 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 18 | 539342 | 539623 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 19 | 3390944 | 3391234 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 20 | 5199679 | 5199969 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 21 | 4494306 | 4494602 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 22 | 3512076 | 3512357 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 23 | 1469369 | 1469623 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 24 | 1591822 | 1592076 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 25 | 3366639 | 3366929 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 26 | 3473123 | 3473407 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 27 | 3488544 | 3488831 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 28 | 4025855 | 4026142 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 29 | 1397968 | 1398249 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 30 | 1841533 | 1841793 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 31 | 2153510 | 2153752 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 32 | 3480783 | 3481031 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 33 | 999423 | 999662 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 34 | 3803233 | 3803523 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 35 | 183522 | 183761 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 36 | 308489 | 308728 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 37 | 182894 | 183133 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 38 | 698664 | 698921 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 39 | 1017989 | 1018291 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011729.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00515.30 | 0.64 | 25 | 81.0 | same-strand | Tetratricopeptide repeat |
| 2 | PF07719.19 | 0.64 | 25 | 81.0 | same-strand | Tetratricopeptide repeat |
| 3 | PF13424.8 | 0.64 | 25 | 81.0 | same-strand | Tetratricopeptide repeat |
| 4 | PF13414.8 | 0.64 | 25 | 81.0 | same-strand | TPR repeat |
| 5 | PF13432.8 | 0.62 | 24 | 78 | same-strand | Tetratricopeptide repeat |
++ More..