Result : EXP02878
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02878 |
| NCBI Accession ID | |
| Organism | Flavonifractor,Catenibacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAACGGGTCTATGCCGATCTGATTCAAAAGGGGCTGAAAACGATTGATGATGTCCCGGAGCGGTTGCGCGACAAGGTGCGCGAACTGCTGAAAACGGCTGAAAGCGGGGGCGGCAATGAGTAA |
| Sequence | MERVYADLIQKGLKTIDDVPERLRDKVRELLKTAESGGGNE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5253756 | 5253860 | - | NZ_CP009288.1 | Paenibacillus durus |
| 2 | 2113962 | 2114090 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 3 | 1593 | 1727 | - | NZ_CP034119.1 | Staphylospora marina |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032364.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04865.16 | 0.67 | 2 | 2764.5 | same-strand | Baseplate J-like protein |
| 2 | PF05105.14 | 0.67 | 2 | 1296.0 | same-strand | Bacteriophage holin family |
++ More..