Protein name |
EXP02876 |
NCBI Accession ID |
|
Organism |
Actinomyces |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGGCTAAGAAGGACGGCGTCATCGAGGTCGAGGGTTCGGTCGTCGAGGCCCTTCCGAATGCGATGTTCCGGGTGGAGCTGAGCCCCTACGACTTGTCCCGTGGTCGCATCGTCTATCGGTACAAGTGA |
Sequence |
MAKKDGVIEVEGSVVEALPNAMFRVELSPYDLSRGRIVYRYK |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl09927. Profile Description: N/A. This domain is found at the N-terminus of RsgA domains. It has an OB fold. |
Pubmed ID |
32601270
|
Domain |
CDD:415806 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
42 |