Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit IX |
NCBI Accession ID | CP001291.1 |
Organism | Gloeothece citriformis (strain PCC 7424) (Cyanothece sp. (strain PCC 7424)) |
Left | 1298070 |
Right | 1298198 |
Strand | + |
Nucleotide Sequence | ATGAAAGGATTGCCTAAATTTTTATCTTTGGGGCCAGTTTTACTGGTACTGTGGTTAAGCGTTCAAGCCACTCTTTTGATTGTCATTAACATTATCTATCCTGATTTATTGTTCTACCCCCTATCTTAG |
Sequence | MKGLPKFLSLGPVLLVLWLSVQATLLIVINIIYPDLLFYPLS |
Source of smORF | Swiss-Prot |
Function | May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}. |
Pubmed ID | 21972240 |
Domain | CDD:420030 |
Functional Category | Others |
Uniprot ID | B7K767 |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1298070 | 1298198 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
2 | 732078 | 732200 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
3 | 1001761 | 1001886 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
4 | 527530 | 527649 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
5 | 4343975 | 4344103 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
6 | 3504030 | 3504149 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
7 | 329772 | 329900 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
8 | 43585 | 43716 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
9 | 2028341 | 2028475 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
10 | 679715 | 679834 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
11 | 5099537 | 5099656 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
12 | 2975515 | 2975634 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
13 | 4875738 | 4875857 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
14 | 3171906 | 3172034 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
15 | 3563700 | 3563825 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
16 | 2220418 | 2220546 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
17 | 4211954 | 4212073 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
18 | 2739338 | 2739466 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
19 | 5549867 | 5549986 | - | NZ_CP031941.1 | Nostoc sphaeroides |
20 | 5748913 | 5749044 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00814.27 | 0.9 | 18 | 738.0 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |