ProsmORF-pred
Result : B7K767
Protein Information
Information Type Description
Protein name Photosystem I reaction center subunit IX
NCBI Accession ID CP001291.1
Organism Gloeothece citriformis (strain PCC 7424) (Cyanothece sp. (strain PCC 7424))
Left 1298070
Right 1298198
Strand +
Nucleotide Sequence ATGAAAGGATTGCCTAAATTTTTATCTTTGGGGCCAGTTTTACTGGTACTGTGGTTAAGCGTTCAAGCCACTCTTTTGATTGTCATTAACATTATCTATCCTGATTTATTGTTCTACCCCCTATCTTAG
Sequence MKGLPKFLSLGPVLLVLWLSVQATLLIVINIIYPDLLFYPLS
Source of smORF Swiss-Prot
Function May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}.
Pubmed ID 21972240
Domain CDD:420030
Functional Category Others
Uniprot ID B7K767
ORF Length (Amino Acid) 42
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 20
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1298070 1298198 + NC_011729.1 Gloeothece citriformis PCC 7424
2 732078 732200 - NC_019748.1 Stanieria cyanosphaera PCC 7437
3 1001761 1001886 + NC_019693.1 Oscillatoria acuminata PCC 6304
4 527530 527649 - NC_019689.1 Pleurocapsa sp. PCC 7327
5 4343975 4344103 + NC_010296.1 Microcystis aeruginosa NIES-843
6 3504030 3504149 - NC_014501.1 Gloeothece verrucosa PCC 7822
7 329772 329900 - NC_019776.1 Cyanobacterium aponinum PCC 10605
8 43585 43716 - NZ_CP018092.1 Synechococcus lividus PCC 6715
9 2028341 2028475 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
10 679715 679834 + NC_019771.1 Anabaena cylindrica PCC 7122
11 5099537 5099656 + NC_014248.1 'Nostoc azollae' 0708
12 2975515 2975634 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
13 4875738 4875857 + NC_010628.1 Nostoc punctiforme PCC 73102
14 3171906 3172034 + NZ_CP042326.1 Euhalothece natronophila Z-M001
15 3563700 3563825 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
16 2220418 2220546 + NC_019780.1 Dactylococcopsis salina PCC 8305
17 4211954 4212073 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
18 2739338 2739466 - NC_019753.1 Crinalium epipsammum PCC 9333
19 5549867 5549986 - NZ_CP031941.1 Nostoc sphaeroides
20 5748913 5749044 + NC_019751.1 Calothrix sp. PCC 6303
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_011729.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00814.27 0.9 18 738.0 opposite-strand tRNA N6-adenosine threonylcarbamoyltransferase
++ More..