Protein name |
EXP02864 |
NCBI Accession ID |
|
Organism |
Subdoligranulum,Roseburia,Coprococcus |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGTACGAAAAAATTAAACTTTGGCATAAAAAAGGCTGGTGGACTCAATCCATGGTTGCCCAAGCCGTCAGGAAGGGACTGATTACCAAAGAACAGTACAAAGCCATTGTGGAAGGGACAGAAAATGAGTAA |
Sequence |
MYEKIKLWHKKGWWTQSMVAQAVRKGLITKEQYKAIVEGTENE |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
Pubmed ID |
32601270
|
Domain |
CDD:420140 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
43 |