Result : B7K1J7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex subunit PetM) (Cytochrome b6-f complex subunit VII) |
| NCBI Accession ID | CP001287.1 |
| Organism | Rippkaea orientalis (strain PCC 8801) (Cyanothece sp. (strain PCC 8801)) |
| Left | 3727821 |
| Right | 3727934 |
| Strand | + |
| Nucleotide Sequence | ATGACGGCAGAAAGTATGATGTTTAACGGGGCTGTTTTATTAATGGTTCTGGTTTTAGTTGGTTTAGCTTGGGGCTTTCTTCTCCTTAAAATTCAAGGGGGAGAAGCCGAATAA |
| Sequence | MTAESMMFNGAVLLMVLVLVGLAWGFLLLKIQGGEAE |
| Source of smORF | Swiss-Prot |
| Function | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. {ECO:0000255|HAMAP-Rule:MF_00396}. |
| Pubmed ID | 21972240 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | B7K1J7 |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4997379 | 4997492 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 2 | 218658 | 218771 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 1722245 | 1722358 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 4 | 2307053 | 2307166 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 5 | 3024394 | 3024507 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 6 | 1564222 | 1564335 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 7 | 2138961 | 2139071 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 8 | 1700790 | 1700900 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 9 | 2292668 | 2292769 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 10 | 1815215 | 1815319 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 11 | 349289 | 349393 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 12 | 5991156 | 5991263 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
++ More..