| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0181 protein YE1782 |
| NCBI Accession ID | AM286415.1 |
| Organism | Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) |
| Left | 1977842 |
| Right | 1978099 |
| Strand | + |
| Nucleotide Sequence | ATGTTAGCGGGTATGCCTTCACTTTCTCATGAGGAACAGCAAGAAGCTGTCGAACGTATTCATCAATTCATGTCGGAAGGGATGAGCAGTGGTGAGGCGATTGCCTTGGTGGCCGCAGAAATCCGTGAGCGGCACCAGAATGATCCACAAGCCATGGCTATCTTTGAAGATACTGACTTTGATGAACATGATGAGTCTGATTATCGTCGCGATAATGAACAGGATGCGGACGAAATAGAAGACCCGTACGAGGGGTAA |
| Sequence | MLAGMPSLSHEEQQEAVERIHQFMSEGMSSGEAIALVAAEIRERHQNDPQAMAIFEDTDFDEHDESDYRRDNEQDADEIEDPYEG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22520. Profile Description: Uncharacterized protein family (UPF0181). This family contains small proteins of about 50 amino acids of unknown function. The family includes YoaH. |
| Pubmed ID | 17173484 |
| Domain | CDD:419844 |
| Functional Category | Others |
| Uniprot ID | A1JLK7 |
| ORF Length (Amino Acid) | 85 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2020011 | 2020268 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 2 | 2041574 | 2041831 | + | NZ_CP043727.1 | Yersinia canariae |
| 3 | 2555639 | 2555896 | - | NZ_CP046293.1 | Yersinia intermedia |
| 4 | 1497359 | 1497616 | + | NZ_CP032487.1 | Yersinia hibernica |
| 5 | 837313 | 837570 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 6 | 2577993 | 2578250 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 7 | 3230647 | 3230904 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 8 | 3665358 | 3665615 | + | NZ_CP007230.1 | Yersinia similis |
| 9 | 921328 | 921585 | - | NZ_CP009787.1 | Yersinia rohdei |
| 10 | 659047 | 659292 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 11 | 4065489 | 4065725 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 12 | 2340375 | 2340614 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 13 | 2069379 | 2069606 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 14 | 1737754 | 1737981 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 15 | 2159139 | 2159366 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 16 | 4362540 | 4362785 | - | NZ_CP065640.1 | Serratia rubidaea |
| 17 | 2426780 | 2426998 | - | NZ_CP050150.1 | Hafnia alvei |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03313.17 | 1.0 | 17 | 2645 | opposite-strand | Serine dehydratase alpha chain |
| 2 | PF03315.17 | 1.0 | 17 | 2645 | opposite-strand | Serine dehydratase beta chain |
| 3 | PF00425.20 | 1.0 | 17 | 175 | opposite-strand | chorismate binding enzyme |
| 4 | PF04715.15 | 1.0 | 17 | 175 | opposite-strand | Anthranilate synthase component I, N terminal region |
| 5 | PF02222.24 | 0.76 | 13 | 68 | opposite-strand | ATP-grasp domain |
| 6 | PF02655.16 | 0.71 | 12 | 68.5 | opposite-strand | ATP-grasp domain |
| 7 | PF00270.31 | 0.65 | 11 | 1577 | same-strand | DEAD/DEAH box helicase |
| 8 | PF00271.33 | 0.65 | 11 | 1577 | same-strand | Helicase conserved C-terminal domain |
| 9 | PF03880.17 | 0.65 | 11 | 1577 | same-strand | DbpA RNA binding domain |
| 10 | PF04851.17 | 0.71 | 12 | 1559.5 | same-strand | Type III restriction enzyme, res subunit |
| 11 | PF03741.18 | 0.71 | 12 | 4187.5 | same-strand | Integral membrane protein TerC family |
| 12 | PF03471.19 | 0.71 | 12 | 4187.5 | same-strand | Transporter associated domain |
| 13 | PF00293.30 | 0.76 | 13 | 1570 | opposite-strand | NUDIX domain |