Protein name |
EXP02849 |
NCBI Accession ID |
|
Organism |
Prevotella,Bilophila |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGAGTGTCGAATATAAGGATTATTACAAAATATTGGGTGTGGGGCGCGAAGCTTCCAAGGATGAAATCGCAAAAGCCTTCAAGAAGCTCGCCCGCAAGTACCACCCGGATCTCAACCCCGGAAACAAGGAATCCGAGGAAAAGTTCAAGTAA |
Sequence |
MSVEYKDYYKILGVGREASKDEIAKAFKKLARKYHPDLNPGNKESEEKFK |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl02542. Profile Description: N/A. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. |
Pubmed ID |
32601270
|
Domain |
CDD:413365 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
50 |