Result : EXP02835
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02835 |
| NCBI Accession ID | |
| Organism | Ruminococcus,Dialister |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCCAAATTGTAGCTACGATAAAGGTCTTTACAAGATAAAGCAAATGAAAAATTTTGTTAAAGCTAAAGCAATCACTCCAGAGGAGTATAAAGAAATTACAGGGGATCTGTATGATGATGATGAAAACTAA |
| Sequence | MPNCSYDKGLYKIKQMKNFVKAKAITPEEYKEITGDLYDDDEN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
| Pubmed ID | 32601270 |
| Domain | CDD:420140 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1732993 | 1733100 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 2 | 328851 | 328967 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
++ More..