Result : EXP02833
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02833 |
| NCBI Accession ID | |
| Organism | Prevotella,Haemophilus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGTAGAAGACGTTAAGTTAGGTTCTAATGGTAGACACCCAGTTCACTTCTATGGTAGACCAGGTGGTATGGTACCAGAGCCAAAGGAAATAATCAAGAGAGCAAAAGAAATCATGGGAGGTGTTAAGTAA |
| Sequence | MVEDVKLGSNGRHPVHFYGRPGGMVPEPKEIIKRAKEIMGGVK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 107
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4415782 | 4415913 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 2 | 3992466 | 3992597 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 3 | 2721718 | 2721849 | - | NZ_CP020953.1 | Clostridium drakei |
| 4 | 5237933 | 5238064 | - | NZ_CP020953.1 | Clostridium drakei |
| 5 | 1477050 | 1477181 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 6 | 4684321 | 4684452 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 7 | 2585812 | 2585943 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 8 | 4388901 | 4389032 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 9 | 1755408 | 1755539 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 10 | 3634253 | 3634384 | - | NZ_CP028842.1 | Clostridium botulinum |
| 11 | 27394 | 27525 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 12 | 3915417 | 3915548 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 13 | 2508071 | 2508199 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 14 | 1882202 | 1882333 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 15 | 312799 | 312930 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 16 | 1917769 | 1917897 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 17 | 1964672 | 1964803 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 18 | 1899187 | 1899318 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 19 | 640098 | 640223 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 20 | 2230006 | 2230137 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 21 | 271443 | 271577 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 22 | 705550 | 705681 | + | NZ_CP014176.1 | Clostridium argentinense |
| 23 | 488827 | 488958 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 24 | 1853062 | 1853193 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 25 | 474717 | 474848 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 26 | 2106664 | 2106792 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 27 | 847574 | 847702 | + | NZ_LR698974.1 | Candidatus Methanomassiliicoccus intestinalis |
| 28 | 2108372 | 2108503 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 29 | 3897539 | 3897688 | - | NZ_CP019870.1 | Clostridioides difficile |
| 30 | 1858902 | 1859033 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 31 | 1014446 | 1014577 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 32 | 1552956 | 1553081 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 33 | 1718182 | 1718304 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 34 | 3709553 | 3709684 | - | NZ_CP009687.1 | Clostridium aceticum |
| 35 | 582719 | 582850 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 36 | 736438 | 736566 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 37 | 3113811 | 3113945 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 38 | 4066358 | 4066489 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 39 | 1094354 | 1094482 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 40 | 394791 | 394919 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 41 | 1679528 | 1679656 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 42 | 1752548 | 1752679 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 43 | 200711 | 200830 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 44 | 1782683 | 1782814 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 45 | 1602709 | 1602834 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 46 | 2660231 | 2660365 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 47 | 1969082 | 1969210 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 48 | 4094616 | 4094753 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 49 | 1491207 | 1491338 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 50 | 1387650 | 1387778 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 51 | 246181 | 246312 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 52 | 154086 | 154205 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 53 | 2622118 | 2622252 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 54 | 2943417 | 2943542 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 55 | 940386 | 940508 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 56 | 2100025 | 2100171 | - | NZ_CP036259.1 | Sporomusa termitida |
| 57 | 1590173 | 1590292 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 58 | 829987 | 830115 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 59 | 1711366 | 1711497 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 60 | 1457724 | 1457846 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 61 | 195577 | 195705 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 62 | 1073972 | 1074100 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 63 | 2159003 | 2159134 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 64 | 1975044 | 1975184 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 65 | 2074256 | 2074399 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 66 | 1075283 | 1075423 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 67 | 2291687 | 2291818 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 68 | 1080113 | 1080241 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 69 | 1095586 | 1095714 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 70 | 399504 | 399629 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 71 | 634367 | 634495 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 72 | 3733181 | 3733312 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 73 | 755414 | 755536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 74 | 496608 | 496742 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 75 | 1038016 | 1038141 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 76 | 2165900 | 2166019 | + | NZ_CP013195.1 | Prevotella enoeca |
| 77 | 3808062 | 3808187 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 78 | 896463 | 896588 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 79 | 1210894 | 1211019 | - | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 80 | 1321384 | 1321509 | - | NZ_CP023863.1 | Prevotella jejuni |
| 81 | 1618971 | 1619093 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 82 | 106180 | 106305 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 83 | 2988483 | 2988608 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 84 | 2010591 | 2010722 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 85 | 1355641 | 1355763 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 86 | 3216802 | 3216948 | - | NC_014624.2 | Eubacterium callanderi |
| 87 | 4153504 | 4153650 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 88 | 1967710 | 1967856 | + | NZ_CP019962.1 | Eubacterium limosum |
| 89 | 1911313 | 1911438 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 90 | 2933840 | 2933968 | - | NZ_AP019736.1 | Alistipes dispar |
| 91 | 1308382 | 1308504 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 92 | 1967726 | 1967851 | + | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 93 | 435776 | 435901 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 94 | 2658790 | 2658918 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 95 | 1193852 | 1193980 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 96 | 5920736 | 5920855 | - | NZ_CP061799.1 | Desulfonema limicola |
| 97 | 339755 | 339880 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 98 | 243706 | 243831 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 99 | 3045033 | 3045161 | - | NZ_AP019735.1 | Alistipes communis |
| 100 | 1573310 | 1573435 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 101 | 900142 | 900267 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 102 | 1160982 | 1161110 | + | NZ_LT608328.1 | Petrimonas mucosa |
| 103 | 1832105 | 1832233 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 104 | 1610632 | 1610757 | + | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 105 | 2987488 | 2987613 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 106 | 3128999 | 3129124 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 107 | 395133 | 395255 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 108 | 3698766 | 3698894 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 109 | 524220 | 524342 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 110 | 1377819 | 1377950 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 111 | 2894580 | 2894702 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 112 | 2975677 | 2975811 | - | NZ_AP023049.1 | Alistipes indistinctus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009633.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01558.20 | 1.0 | 107 | 754.0 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 2 | PF02775.23 | 0.99 | 106 | 1.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 3 | PF12838.9 | 1.0 | 107 | 955 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF12837.9 | 0.87 | 93 | 955 | same-strand | 4Fe-4S binding domain |
| 5 | PF00037.29 | 0.96 | 103 | 955 | same-strand | 4Fe-4S binding domain |
| 6 | PF13237.8 | 0.96 | 103 | 956.0 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF12797.9 | 0.93 | 99 | 956 | same-strand | 4Fe-4S binding domain |
| 8 | PF13187.8 | 0.98 | 105 | 955 | same-strand | 4Fe-4S dicluster domain |
++ More..