Result : B7J583
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001219.1 |
| Organism | Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270)) |
| Left | 501678 |
| Right | 501953 |
| Strand | + |
| Nucleotide Sequence | ATGGCACGAGTAACAGTAGAAGATTGTCTGGAGCATGTGGACAATCGTTTTGAATTAACTTTGGTGGCGGCGCGACGGGCGCGGCAATTGGCCTCCGGCGCTGCGCCGGAAGTGGAGCCGGGACGTGACAAAAATACGGTCATAGCTCTGCGCGAAGTGGCCGCCGGCAAGGTGAGCCGGGCGATTCTGGACGAGCAGATGCCGCCACCGTTACCCAACTTCCCCGGTGCAGCGAACCGCGAGGCAACTGGAGCTGAGGATGCCGCTGGCGAGTGA |
| Sequence | MARVTVEDCLEHVDNRFELTLVAARRARQLASGAAPEVEPGRDKNTVIALREVAAGKVSRAILDEQMPPPLPNFPGAANREATGAEDAAGE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 19077236 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B7J583 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 501678 | 501953 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 2 | 2205171 | 2205446 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 3 | 1727854 | 1728129 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 4 | 2458725 | 2459000 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 5 | 1934690 | 1934965 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 6 | 2124134 | 2124394 | + | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 7 | 2464252 | 2464512 | + | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 8 | 3540964 | 3541230 | + | NZ_CP043420.1 | Kushneria phosphatilytica |
| 9 | 3633891 | 3634166 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 10 | 3835745 | 3836020 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 11 | 2321722 | 2321946 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 12 | 829470 | 829724 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 13 | 2929012 | 2929284 | + | NZ_CP031222.1 | Aquirhabdus parva |
| 14 | 2758872 | 2759096 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 15 | 1260466 | 1260717 | - | NZ_CP021323.1 | Kushneria konosiri |
| 16 | 2032223 | 2032474 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 17 | 2988678 | 2988929 | + | NZ_AP018933.1 | Zymobacter palmae |
| 18 | 6005899 | 6006165 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 19 | 4681213 | 4681485 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 20 | 7533344 | 7533604 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 21 | 4026531 | 4026791 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
| 22 | 4356306 | 4356566 | - | NZ_CP065135.1 | Halomonas venusta |
| 23 | 4572369 | 4572596 | + | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 24 | 4264790 | 4265041 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 25 | 851138 | 851404 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 26 | 5919434 | 5919700 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 27 | 1902190 | 1902414 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 28 | 5362806 | 5363099 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 29 | 194504 | 194800 | - | NZ_CP045871.1 | Litoricola lipolytica |
| 30 | 2673719 | 2673943 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007029.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.93 | 28 | 90.0 | same-strand | Guanylate kinase |
| 2 | PF13328.8 | 0.97 | 29 | 45 | same-strand | HD domain |
| 3 | PF04607.19 | 0.93 | 28 | 45.0 | same-strand | Region found in RelA / SpoT proteins |
| 4 | PF02824.23 | 1.0 | 30 | 45.0 | same-strand | TGS domain |
| 5 | PF13291.8 | 0.93 | 28 | 45.0 | same-strand | ACT domain |
| 6 | PF01966.24 | 0.93 | 28 | 45.0 | same-strand | HD domain |
| 7 | PF01042.23 | 0.97 | 29 | 2267 | same-strand | Endoribonuclease L-PSP |
| 8 | PF00271.33 | 0.7 | 21 | 3686.0 | same-strand | Helicase conserved C-terminal domain |
| 9 | PF00270.31 | 0.7 | 21 | 3174.0 | same-strand | DEAD/DEAH box helicase |
| 10 | PF17191.6 | 0.7 | 21 | 3826 | same-strand | RecG wedge domain |
| 11 | PF04851.17 | 0.77 | 23 | 3375.5 | same-strand | Type III restriction enzyme, res subunit |
| 12 | PF13671.8 | 0.6 | 18 | 92 | same-strand | AAA domain |
++ More..