Result : EXP02828
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02828 |
| NCBI Accession ID | |
| Organism | Veillonella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATTAAAGCTGAAGGTTTTTTGGCTAGAATTTTTCAACATGAAATAGATCATTTAGAAGGTCATTTATTTATTGAAAAAGCTACAAACTTACGCCGTATTGCAGATCATCCGGAGGAAAAGGAAATTGTCTAA |
| Sequence | MIKAEGFLARIFQHEIDHLEGHLFIEKATNLRRIADHPEEKEIV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 947756 | 947869 | + | NZ_LT906470.1 | Veillonella rodentium |
| 2 | 1203095 | 1203208 | - | NZ_LR778174.1 | Veillonella parvula |
| 3 | 1158285 | 1158398 | - | NZ_LR134375.1 | Veillonella dispar |
| 4 | 1658506 | 1658616 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 5 | 852487 | 852612 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 6 | 2000750 | 2000884 | - | NZ_CP005973.1 | Photobacterium gaetbulicola Gung47 |
| 7 | 1341015 | 1341167 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 8 | 2964017 | 2964148 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 9 | 1391846 | 1391971 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 10 | 877202 | 877327 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 11 | 2815581 | 2815706 | - | NZ_CP070511.1 | Parageobacillus toebii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906470.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01192.24 | 0.73 | 8 | 5661.0 | same-strand | RNA polymerase Rpb6 |
| 2 | PF04127.17 | 0.73 | 8 | 4361.5 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 3 | PF02441.21 | 0.73 | 8 | 4361.5 | same-strand | Flavoprotein |
| 4 | PF17764.3 | 0.73 | 8 | 389.0 | same-strand | 3'DNA-binding domain (3'BD) |
| 5 | PF04851.17 | 0.82 | 9 | 389 | same-strand | Type III restriction enzyme, res subunit |
| 6 | PF00270.31 | 0.82 | 9 | 389 | same-strand | DEAD/DEAH box helicase |
| 7 | PF18319.3 | 0.73 | 8 | 389.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 8 | PF18074.3 | 0.73 | 8 | 389.0 | same-strand | Primosomal protein N C-terminal domain |
| 9 | PF00551.21 | 0.73 | 8 | 0.0 | same-strand | Formyl transferase |
| 10 | PF02911.20 | 0.73 | 8 | 0.0 | same-strand | Formyl transferase, C-terminal domain |
| 11 | PF01189.19 | 0.73 | 8 | 1760.5 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 12 | PF01029.20 | 0.73 | 8 | 1760.5 | same-strand | NusB family |
++ More..