Result : B7J4X0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001219.1 |
| Organism | Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270)) |
| Left | 1864613 |
| Right | 1864900 |
| Strand | - |
| Nucleotide Sequence | ATGGCATTCGATCAGGATACGGTGCGGCGCACGGCACATCTGGCCCGCATTGCGCTGCCCCAGGCGGAGATACCCGCAGTGGCCGATCAGTTGGAGCGCATCATGGGGCTGGTGGAAGAGTTGCGCGCGATCGAGACGACGGATGTCCCGATCATGGCCCATCCCCTTGACCTGGATCAGCCCCTGCGTCCGGATATGGTTGTCCATCAGGATCAGCGTGAGGTGCTCATGGCAAGTGCCCCGGCGGCTGAGCACGGGCTTTTTCTCGTCCCCAAAGTTATCGAGTAG |
| Sequence | MAFDQDTVRRTAHLARIALPQAEIPAVADQLERIMGLVEELRAIETTDVPIMAHPLDLDQPLRPDMVVHQDQREVLMASAPAAEHGLFLVPKVIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 19077236 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B7J4X0 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1864613 | 1864900 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 2 | 255138 | 255425 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 3 | 1281151 | 1281438 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 4 | 798696 | 798983 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 5 | 2071895 | 2072188 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 6 | 2482349 | 2482636 | + | NZ_CP011797.1 | Reinekea forsetii |
| 7 | 1297972 | 1298259 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
| 8 | 1940364 | 1940657 | - | NZ_CP023276.1 | Polynucleobacter difficilis |
| 9 | 2571403 | 2571690 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 10 | 2656630 | 2656917 | + | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 11 | 2092316 | 2092609 | - | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011761.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 1.0 | 11 | 1488 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 1.0 | 11 | 1488 | same-strand | GatB domain |
| 3 | PF01425.23 | 1.0 | 11 | 12 | same-strand | Amidase |
++ More..