Result : B7J245
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001205.1 |
| Organism | Borrelia burgdorferi (strain ZS7) |
| Left | 493990 |
| Right | 494286 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGCTTATGATATAATAGTTTCACCTATGCTTACTGAAAAAACTAATACTCAAAGGGAAAGTATTAATGTTTATGTTTTTAAAGTTAATAAGAGAGCAAATAAAAAAGAGGTTGGTGCAGCAATAAAAGAACTTTTCAATGTTACTCCAGTATCGTGTAATTTGCTAAATATTAAAAGTAAAGCCAAGGTTGTGGTGTCTAGAAAAGGGTACCCTATAGGTAAGGGAAAAACTTCTTCATGGAAGAAGGCATATGTTTATCTCAAAAAGGAAGATAAAATAGATATTTTTTAG |
| Sequence | MKAYDIIVSPMLTEKTNTQRESINVYVFKVNKRANKKEVGAAIKELFNVTPVSCNLLNIKSKAKVVVSRKGYPIGKGKTSSWKKAYVYLKKEDKIDIF |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 20935092 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B7J245 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 496575 | 496871 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 500730 | 501026 | + | NZ_CP028861.1 | Borreliella garinii |
| 3 | 499006 | 499302 | + | NZ_CP015796.1 | Borreliella mayonii |
| 4 | 496130 | 496426 | + | NZ_CP044535.1 | Borrelia maritima |
| 5 | 500436 | 500732 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 6 | 500564 | 500860 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 7 | 503136 | 503432 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 8 | 407497 | 407793 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 9 | 494221 | 494517 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 10 | 517676 | 517972 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 11 | 517604 | 517900 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015921.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 1.0 | 11 | 1677 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03143.19 | 1.0 | 11 | 1677 | same-strand | Elongation factor Tu C-terminal domain |
| 3 | PF03144.27 | 1.0 | 11 | 1677 | same-strand | Elongation factor Tu domain 2 |
| 4 | PF01926.25 | 1.0 | 11 | 1677 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF00338.24 | 1.0 | 11 | 1318 | same-strand | Ribosomal protein S10p/S20e |
| 6 | PF00573.24 | 1.0 | 11 | 22 | same-strand | Ribosomal protein L4/L1 family |
| 7 | PF03947.20 | 1.0 | 11 | 22 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 8 | PF00181.25 | 1.0 | 11 | 22 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 9 | PF00203.23 | 1.0 | 11 | 865 | same-strand | Ribosomal protein S19 |
| 10 | PF00237.21 | 1.0 | 11 | 1146 | same-strand | Ribosomal protein L22p/L17e |
| 11 | PF00189.22 | 1.0 | 11 | 1515 | same-strand | Ribosomal protein S3, C-terminal domain |
| 12 | PF07650.19 | 1.0 | 11 | 1515 | same-strand | KH domain |
| 13 | PF00252.20 | 0.91 | 10 | 2375.5 | same-strand | Ribosomal protein L16p/L10e |
++ More..