Result : EXP02811
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02811 |
| NCBI Accession ID | |
| Organism | Streptococcus,Enterococcus,Lachnoanaerobaculum,Ruminococcus,Oscillibacter,Lactobacillus,Subdoligranulum,Megasphaera,Faecalibacterium,Clostridium,Abiotrophia,Veillonella,Selenomonas,Parabacteroides,Lachnospira,Lachnoclostridium,Gemmiger,Dorea,Coprococcus,Clostridioides,Butyricicoccus,Angelakisella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGTCGCTTTTTTAAATTTGGAAAGTTACACGTTACTAAAGGGAATGGAGATAAATTATTAGATATACTACTGACAGCTTCCAAGAAGCTAAAGAGGTCCCTAGCGCCTACGGGGAATTTGTATCGATAA |
| Sequence | MSRFFKFGKLHVTKGNGDKLLDILLTASKKLKRSLAPTGNLYR |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3493573 | 3493704 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 2 | 797531 | 797662 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 3 | 11905 | 12036 | - | NZ_AP022823.1 | Enterococcus saigonensis |
| 4 | 1239551 | 1239682 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 5 | 1100945 | 1101076 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 6 | 240277 | 240408 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 7 | 1336607 | 1336738 | - | NZ_CP032819.1 | Butyricimonas faecalis |
| 8 | 1695802 | 1695933 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 9 | 888333 | 888464 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 10 | 1479755 | 1479886 | + | NZ_CP046314.1 | Gemella morbillorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022822.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00398.22 | 1.0 | 9 | 5.0 | same-strand | Ribosomal RNA adenine dimethylase |
| 2 | PF00239.23 | 0.78 | 7 | 219.0 | same-strand | Resolvase, N terminal domain |
++ More..