Result : B7J1B7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP001205.1 |
| Organism | Borrelia burgdorferi (strain ZS7) |
| Left | 186646 |
| Right | 186891 |
| Strand | + |
| Nucleotide Sequence | ATGCTAGTATTGTCAAGAAAAGCAAATGAAAGCATTAAAATAAATTCTGATATTGAGGTTTTAATATTAGAAATAAAAAAGGATGCTGTTAAAATAGCAATTAAAGCCCCTGAAAACATTAAAATATTTAGATCTGAAATTTATGAATTTATTATAGAAGAAAACAAAAAATCACTACTAAAAGACAAACACAATATAAGCAAAATTAAAAGCCTTTTTAATCATTATTTCAAGAATGAAAATTAA |
| Sequence | MLVLSRKANESIKINSDIEVLILEIKKDAVKIAIKAPENIKIFRSEIYEFIIEENKKSLLKDKHNISKIKSLFNHYFKNEN |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 20935092 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | B7J1B7 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 186612 | 186857 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 188121 | 188366 | + | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 186650 | 186895 | + | NZ_CP028861.1 | Borreliella garinii |
| 4 | 186166 | 186411 | + | NZ_CP044535.1 | Borrelia maritima |
| 5 | 185748 | 185984 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 6 | 197966 | 198202 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 7 | 185393 | 185629 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 8 | 185468 | 185704 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 9 | 184356 | 184592 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 10 | 190891 | 191139 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 11 | 720919 | 721167 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 12 | 2296981 | 2297211 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 13 | 565122 | 565340 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 14 | 777447 | 777674 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 15 | 949564 | 949791 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 16 | 2699914 | 2700138 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 17 | 2415594 | 2415803 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015921.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06429.15 | 0.65 | 11 | 1674 | same-strand | Flagellar basal body rod FlgEFG protein C-terminal |
| 2 | PF00669.22 | 0.65 | 11 | 397 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF00700.23 | 0.88 | 15 | 397 | same-strand | Bacterial flagellin C-terminal helical region |
| 4 | PF02623.17 | 1.0 | 17 | 3 | same-strand | FliW protein |
| 5 | PF02367.19 | 0.65 | 11 | 630 | opposite-strand | Threonylcarbamoyl adenosine biosynthesis protein TsaE |
| 6 | PF00453.20 | 0.65 | 11 | 1516 | opposite-strand | Ribosomal protein L20 |
| 7 | PF01632.21 | 0.65 | 11 | 1883 | opposite-strand | Ribosomal protein L35 |
++ More..