Result : EXP02796

Protein Information

• Protein name: EXP02796
• Organism: Clostridium,Tenacibaculum,Lachnoclostridium,Flavonifractor,Colletotrichum
• Nucleotide Sequence: ATGTTTGAAACCATCAAAAGATTGTACTCCAAATCCGGTGACTCGGTTATCGTCTCCAACGCGGTCAAGAAGGGGTGGATTACTGCCGAGCAGTATGAAGAAATCACCGGCGATAAACACACGGGAAGCTGA
• Sequence: MFETIKRLYSKSGDSVIVSNAVKKGWITAEQYEEITGDKHTGS
• Source of smORF: Metagenomic Ribo-seq
• Function: The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions]
• Pubmed ID: 32601270
• Domain: CDD:420140
• Functional Category: Conserved domain based functional assignment
• ORF Length (Amino Acid): 43

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	626492	626626	+	NC_015520.1	Mahella australiensis 50-1 BON
2	2126372	2126503	-	NZ_CP019401.1	Planococcus faecalis
3	765517	765654	+	NC_015172.1	Syntrophobotulus glycolicus DSM 8271

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_015172.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF10076.11	0.67	2	2222.0	same-strand	Uncharacterised protein conserved in bacteria (DUF2313)
2	PF04865.16	0.67	2	2116.5	same-strand	Baseplate J-like protein