Result : B7IMV6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0349 protein BCG9842_B0165 |
| NCBI Accession ID | CP001186.1 |
| Organism | Bacillus cereus (strain G9842) |
| Left | 4847065 |
| Right | 4847304 |
| Strand | - |
| Nucleotide Sequence | TTGATTAAACCATTAATTGAATTTTGTGTAGGTAACCTTGCAAGTGGTTCACAAGCAGCTTTAGAGAAATTAGAAAAAGATCCGAATTTAGATGTAATGGAGTATGGTTGTTTAGGATATTGTGGCATTTGTTTTGAAGGACCGTTTGCACTTGTAAATGGTGAAGTTGTACAAGGTGCTACAGTAGAAGAACTGGTCAATAATGTATATGATTATTTGGATGAAAATCCAATGTTTTAA |
| Sequence | MIKPLIEFCVGNLASGSQAALEKLEKDPNLDVMEYGCLGYCGICFEGPFALVNGEVVQGATVEELVNNVYDYLDENPMF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11488. Profile Description: Protein of unknown function (DUF1450). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:416296 |
| Functional Category | Others |
| Uniprot ID | B7IMV6 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 100
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 448595 | 448834 | + | NZ_CP040336.1 | Bacillus luti |
| 2 | 4699629 | 4699868 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 4894983 | 4895222 | - | NC_011725.1 | Bacillus cereus B4264 |
| 4 | 4729022 | 4729261 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 5 | 4932033 | 4932272 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 6 | 3609064 | 3609303 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 1882627 | 1882863 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 8 | 4710791 | 4711030 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 9 | 3692426 | 3692662 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 10 | 1004291 | 1004530 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 11 | 3839872 | 3840111 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 12 | 3977405 | 3977644 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 13 | 630497 | 630736 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 14 | 665855 | 666091 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 15 | 33765 | 34004 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 16 | 3229035 | 3229274 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 17 | 2621864 | 2622103 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 3527368 | 3527604 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 19 | 877779 | 878015 | + | NZ_CP011937.1 | Bacillus velezensis |
| 20 | 3107552 | 3107788 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 21 | 3103236 | 3103472 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 22 | 2489638 | 2489874 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 23 | 2912079 | 2912315 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 24 | 2396001 | 2396237 | + | NZ_CP043404.1 | Bacillus safensis |
| 25 | 2739586 | 2739825 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 26 | 3175401 | 3175637 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 27 | 3114422 | 3114658 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 28 | 3172540 | 3172776 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 29 | 3308368 | 3308604 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 30 | 2178310 | 2178549 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 31 | 726197 | 726433 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 32 | 2430682 | 2430918 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 33 | 3379884 | 3380120 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 34 | 3216114 | 3216350 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 35 | 2986035 | 2986274 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 36 | 2934593 | 2934832 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 37 | 2400801 | 2401040 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 38 | 3093303 | 3093539 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 39 | 2955963 | 2956199 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 40 | 1252311 | 1252547 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 41 | 863072 | 863311 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 42 | 3036631 | 3036867 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 43 | 2403439 | 2403678 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 44 | 3646021 | 3646257 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 45 | 2688348 | 2688584 | - | NZ_CP012024.1 | Bacillus smithii |
| 46 | 2179984 | 2180220 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 47 | 309536 | 309775 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 48 | 3361492 | 3361728 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 49 | 1109874 | 1110110 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 50 | 1957679 | 1957915 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 51 | 1246988 | 1247224 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 52 | 1019544 | 1019780 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 53 | 592434 | 592670 | + | NZ_CP013661.2 | Planococcus kocurii |
| 54 | 1177882 | 1178118 | - | NZ_CP019401.1 | Planococcus faecalis |
| 55 | 982859 | 983095 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 56 | 1117694 | 1117930 | - | NZ_CP016540.2 | Planococcus versutus |
| 57 | 1152263 | 1152499 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 58 | 2928012 | 2928248 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 59 | 263619 | 263855 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 60 | 921466 | 921702 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 61 | 1058832 | 1059044 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 62 | 1167568 | 1167804 | - | NZ_CP016538.2 | Planococcus maritimus |
| 63 | 3662275 | 3662511 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 64 | 1071198 | 1071434 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 65 | 1178293 | 1178529 | - | NZ_CP059540.1 | Planococcus maritimus |
| 66 | 1203234 | 1203470 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 67 | 2467388 | 2467621 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 68 | 3653710 | 3653946 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 69 | 3250463 | 3250699 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 70 | 3475591 | 3475827 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 71 | 2384196 | 2384429 | - | NZ_LT906444.1 | Listeria welshimeri |
| 72 | 2314719 | 2314958 | - | NZ_LR134483.1 | Listeria grayi |
| 73 | 2288439 | 2288672 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 74 | 1069579 | 1069806 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 75 | 3992607 | 3992843 | - | NZ_CP053989.1 | Niallia circulans |
| 76 | 3254324 | 3254560 | - | NZ_LS483476.1 | Lederbergia lentus |
| 77 | 562203 | 562439 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 78 | 2367350 | 2367583 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 79 | 2494330 | 2494563 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 80 | 811677 | 811913 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 81 | 601502 | 601735 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 82 | 856118 | 856354 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 83 | 1781471 | 1781674 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 84 | 1900159 | 1900395 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 85 | 1873713 | 1873916 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 86 | 3497296 | 3497568 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 87 | 2102567 | 2102761 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 88 | 1876594 | 1876806 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 89 | 345356 | 345592 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 90 | 2065512 | 2065724 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 91 | 1554923 | 1555153 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 92 | 1476787 | 1477011 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 93 | 403095 | 403307 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 94 | 1816868 | 1817104 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 95 | 2864025 | 2864255 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 96 | 2894675 | 2894905 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 97 | 2403040 | 2403255 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 98 | 610092 | 610304 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 99 | 1046701 | 1046964 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 100 | 2316644 | 2316838 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 101 | 780973 | 781209 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017703.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.97 | 97 | 587.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF00070.29 | 0.97 | 97 | 587.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 3 | PF01521.22 | 0.89 | 89 | 1263.0 | same-strand | Iron-sulphur cluster biosynthesis |
| 4 | PF01106.19 | 0.87 | 87 | 1879.0 | opposite-strand | NifU-like domain |
| 5 | PF07315.13 | 0.86 | 86 | 1372 | same-strand | Protein of unknown function (DUF1462) |
++ More..